CHST3 Antibody - #DF9329
| Product: | CHST3 Antibody |
| Catalog: | DF9329 |
| Description: | Rabbit polyclonal antibody to CHST3 |
| Application: | WB IHC |
| Reactivity: | Human |
| Prediction: | Pig, Bovine, Horse, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 55 kDa; 55kD(Calculated). |
| Uniprot: | Q7LGC8 |
| RRID: | AB_2842525 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9329, RRID:AB_2842525.
Fold/Unfold
C6ST 1; C6ST; C6ST-1; C6ST1; Carbohydrate (chondroitin 6) sulfotransferase 3; Carbohydrate sulfotransferase 3; Chondroitin 6 O sulfotransferase 1; Chondroitin 6 sulfotransferase; Chondroitin 6-O-sulfotransferase 1; Chondroitin 6-sulfotransferase; CHST 3; Chst3; CHST3_HUMAN; Galactose/N acetylglucosamine/N acetylglucosamine 6 O sulfotransferase 0; Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 0; GST 0; GST-0; GST0;
Immunogens
Widely expressed in adult tissues. Expressed in heart, placenta, skeletal muscle and pancreas. Also expressed in various immune tissues such as spleen, lymph node, thymus and appendix.
- Q7LGC8 CHST3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEKGLTLPQDCRDFVHSLKMRSKYALFLVFVVIVFVFIEKENKIISRVSDKLKQIPQALADANSTDPALILAENASLLSLSELDSAFSQLQSRLRNLSLQLGVEPAMEAAGEEEEEQRKEEEPPRPAVAGPRRHVLLMATTRTGSSFVGEFFNQQGNIFYLFEPLWHIERTVSFEPGGANAAGSALVYRDVLKQLFLCDLYVLEHFITPLPEDHLTQFMFRRGSSRSLCEDPVCTPFVKKVFEKYHCKNRRCGPLNVTLAAEACRRKEHMALKAVRIRQLEFLQPLAEDPRLDLRVIQLVRDPRAVLASRMVAFAGKYKTWKKWLDDEGQDGLREEEVQRLRGNCESIRLSAELGLRQPAWLRGRYMLVRYEDVARGPLQKAREMYRFAGIPLTPQVEDWIQKNTQAAHDGSGIYSTQKNSSEQFEKWRFSMPFKLAQVVQAACGPAMRLFGYKLARDAAALTNRSVSLLEERGTFWVT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q7LGC8 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K239 | Acetylation | Uniprot | |
| K273 | Methylation | Uniprot | |
| S309 | Phosphorylation | Uniprot | |
| R342 | Methylation | Uniprot | |
| T394 | Phosphorylation | Uniprot | |
| K419 | Ubiquitination | Uniprot | |
| K427 | Ubiquitination | Uniprot |
Research Backgrounds
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the transfer of sulfate to position 6 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. Can also sulfate Gal residues of keratan sulfate, another glycosaminoglycan, and the Gal residues in sialyl N-acetyllactosamine (sialyl LacNAc) oligosaccharides. May play a role in the maintenance of naive T-lymphocytes in the spleen.
Golgi apparatus membrane>Single-pass type II membrane protein.
Widely expressed in adult tissues. Expressed in heart, placenta, skeletal muscle and pancreas. Also expressed in various immune tissues such as spleen, lymph node, thymus and appendix.
Belongs to the sulfotransferase 1 family. Gal/GlcNAc/GalNAc subfamily.
Research Fields
· Metabolism > Glycan biosynthesis and metabolism > Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.