CHST11 Antibody - #DF9327
| Product: | CHST11 Antibody |
| Catalog: | DF9327 |
| Description: | Rabbit polyclonal antibody to CHST11 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 42 kDa; 42kD(Calculated). |
| Uniprot: | Q9NPF2 |
| RRID: | AB_2842523 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9327, RRID:AB_2842523.
Fold/Unfold
C4S-1; C4ST 1; C4ST; C4ST-1; C4ST1; Carbohydrate (chondroitin 4) sulfotransferase 11; Carbohydrate sulfotransferase 11; Chondroitin 4 O sulfotransferase 1; Chondroitin 4 sulfotransferase; Chondroitin 4-O-sulfotransferase 1; Chondroitin 4-sulfotransferase 1; CHST 11; Chst11; CHSTB_HUMAN; HSA269537; IgH/CHST11 fusion;
Immunogens
Widely expressed. Highly expressed in spleen, thymus, bone marrow, peripheral blood leukocytes, lymph node, heart, brain, lung and placenta.
- Q9NPF2 CHSTB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKPALLEVMRMNRICRMVLATCLGSFILVIFYFQSMLHPVMRRNPFGVDICCRKGSRSPLQELYNPIQLELSNTAVLHQMRRDQVTDTCRANSATSRKRRVLTPNDLKHLVVDEDHELIYCYVPKVACTNWKRLMMVLTGRGKYSDPMEIPANEAHVSANLKTLNQYSIPEINHRLKSYMKFLFVREPFERLVSAYRNKFTQKYNISFHKRYGTKIIKRQRKNATQEALRKGDDVKFEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDSNYVLQLAGVGSYLKFPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVYKLDFLMFNYSVPSYLKLE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NPF2 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K2 | Ubiquitination | Uniprot | |
| K143 | Ubiquitination | Uniprot | |
| K162 | Ubiquitination | Uniprot | |
| K210 | Ubiquitination | Uniprot | |
| N342 | N-Glycosylation | Uniprot |
Research Backgrounds
Catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. Can also sulfate Gal residues in desulfated dermatan sulfate. Preferentially sulfates in GlcA->GalNAc unit than in IdoA->GalNAc unit. Does not form 4, 6-di-O-sulfated GalNAc when chondroitin sulfate C is used as an acceptor.
N-glycosylated; required for activity and stability.
Golgi apparatus membrane>Single-pass type II membrane protein.
Widely expressed. Highly expressed in spleen, thymus, bone marrow, peripheral blood leukocytes, lymph node, heart, brain, lung and placenta.
Belongs to the sulfotransferase 2 family.
Research Fields
· Metabolism > Glycan biosynthesis and metabolism > Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.