BRAP Antibody - #DF9289
| Product: | BRAP Antibody |
| Catalog: | DF9289 |
| Description: | Rabbit polyclonal antibody to BRAP |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Prediction: | Pig, Bovine, Horse, Sheep, Dog, Xenopus |
| Mol.Wt.: | 67 kDa; 67kD(Calculated). |
| Uniprot: | Q7Z569 |
| RRID: | AB_2842485 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9289, RRID:AB_2842485.
Fold/Unfold
3010002G07Rik; BRAP2; BRCA1 associated protein; EC 6.3.2.; Galectin 2 binding protein; IMP; Impedes mitogenic signal propagation; Renal carcinoma antigen NY REN 63; RING finger protein 52; RNF52; zgc:92894;
Immunogens
- Q7Z569 BRAP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSVSLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAIIHQHLGRREMTDVIIETMKSNPDELKTTVEERKSSEASPTAQRSKDHSKECINAAPDSPSKQLPDQISFFSGNPSVEIVHGIMHLYKTNKMTSLKEDVRRSAMLCILTVPAAMTSHDLMKFVAPFNEVIEQMKIIRDSTPNQYMVLIKFRAQADADSFYMTCNGRQFNSIEDDVCQLVYVERAEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWDDTTCPVCRYCQTPEPVEENKCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVHRLVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQRIYWENKIVRIEKDTAEEINNMKTKFKETIEKCDNLEHKLNDLLKEKQSVERKCTQLNTKVAKLTNELKEEQEMNKCLRANQVLLQNKLKEEERVLKETCDQKDLQITEIQEQLRDVMFYLETQQKINHLPAETRQEIQEGQINIAMASASSPASSGGSGKLPSRKGRSKRGK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q7Z569 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K38 | Ubiquitination | Uniprot | |
| S43 | Phosphorylation | Uniprot | |
| K51 | Ubiquitination | Uniprot | |
| S52 | Phosphorylation | Uniprot | |
| S79 | Phosphorylation | Uniprot | |
| K85 | Acetylation | Uniprot | |
| K85 | Ubiquitination | Uniprot | |
| S93 | Phosphorylation | Uniprot | |
| S94 | Phosphorylation | Uniprot | |
| S97 | Phosphorylation | Uniprot | |
| T99 | Phosphorylation | Uniprot | |
| S107 | Phosphorylation | Uniprot | |
| S117 | Phosphorylation | Uniprot | |
| S119 | Phosphorylation | Uniprot | |
| K154 | Ubiquitination | Uniprot | |
| T173 | Phosphorylation | Uniprot | |
| S286 | Phosphorylation | Uniprot | |
| S289 | Phosphorylation | Uniprot | |
| T308 | Phosphorylation | Uniprot | |
| T352 | Phosphorylation | Uniprot | |
| T361 | Phosphorylation | Uniprot | |
| K381 | Ubiquitination | Uniprot | |
| K385 | Ubiquitination | Uniprot | |
| Y389 | Phosphorylation | Uniprot | |
| K400 | Ubiquitination | Uniprot | |
| Y422 | Phosphorylation | Uniprot | |
| K426 | Ubiquitination | Uniprot | |
| K444 | Ubiquitination | Uniprot | |
| K446 | Ubiquitination | Uniprot | |
| K458 | Acetylation | Uniprot | |
| K458 | Ubiquitination | Uniprot | |
| K464 | Ubiquitination | Uniprot | |
| K482 | Ubiquitination | Uniprot | |
| K507 | Ubiquitination | Uniprot | |
| K522 | Ubiquitination | Uniprot | |
| S570 | Phosphorylation | Uniprot | |
| K580 | Ubiquitination | Uniprot |
Research Backgrounds
Negatively regulates MAP kinase activation by limiting the formation of Raf/MEK complexes probably by inactivation of the KSR1 scaffold protein. Also acts as a Ras responsive E3 ubiquitin ligase that, on activation of Ras, is modified by auto-polyubiquitination resulting in the release of inhibition of Raf/MEK complex formation. May also act as a cytoplasmic retention protein with a role in regulating nuclear transport.
Cytoplasm.
Expressed in breast epithelial cell lines.
Interacts with the nuclear localization signal of BRCA1 and with the N-terminal of KSR1. The C-terminal portion of BCRA1 interacts with DDB1.
Research Fields
· Environmental Information Processing > Signal transduction > Ras signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.