B4GALT6 Antibody - #DF9275
| Product: | B4GALT6 Antibody |
| Catalog: | DF9275 |
| Description: | Rabbit polyclonal antibody to B4GALT6 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 45 kDa; 45kD(Calculated). |
| Uniprot: | Q9UBX8 |
| RRID: | AB_2842471 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9275, RRID:AB_2842471.
Fold/Unfold
4-galactosyltransferase 6; 4-galactosyltransferase; 4-GalTase 6; AA536803; AU022389; b4Gal-T6; B4galt6; B4GT6_HUMAN; Beta-1; beta-1,4-galactosyltransferase 6; beta-1,4-GalTase 6; Beta4Gal-T6; beta4GalT-VI; LacCer synthase; Lactosylceramide synthase; UDP-Gal:beta-GlcNAc beta-1; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 6; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6; UDP-Gal:glucosylceramide beta-1; UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase; UDP-galactose:beta-N-acetylglucosamine beta-1; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 6;
Immunogens
High expression in brain and adrenal gland, lower in liver, lung, colon and peripheral white blood cells.
- Q9UBX8 B4GT6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSVLRRMMRVSNRSLLAFIFFFSLSSSCLYFIYVAPGIANTYLFMVQARGIMLRENVKTIGHMIRLYTNKNSTLNGTDYPEGNNSSDYLVQTTTYLPENFTYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWKVAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDSVWDCVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEGDLGKYKSIPHHHRGEVQFLGRYKLLRYSKERQYIDGLNNLIYRPKILVDRLYTNISVNLMPELAPIEDY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9UBX8 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y340 | Phosphorylation | Uniprot | |
| Y346 | Phosphorylation | Uniprot | |
| Y355 | Phosphorylation | Uniprot | |
| Y382 | Phosphorylation | Uniprot |
Research Backgrounds
Catalyzes the synthesis of lactosylceramide (LacCer) via the transfer of galactose from UDP-galactose to glucosylceramide (GlcCer). LacCer is the starting point in the biosynthesis of all gangliosides (membrane-bound glycosphingolipids) which play pivotal roles in the CNS including neuronal maturation and axonal and myelin formation (By similarity).
Golgi apparatus>Golgi stack membrane>Single-pass type II membrane protein.
Note: Trans cisternae of Golgi stack.
High expression in brain and adrenal gland, lower in liver, lung, colon and peripheral white blood cells.
Belongs to the glycosyltransferase 7 family.
Research Fields
· Metabolism > Lipid metabolism > Sphingolipid metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.