B4GALT4 Antibody - #DF9274
Product: | B4GALT4 Antibody |
Catalog: | DF9274 |
Description: | Rabbit polyclonal antibody to B4GALT4 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit |
Mol.Wt.: | 40 kDa; 40kD(Calculated). |
Uniprot: | O60513 |
RRID: | AB_2842470 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9274, RRID:AB_2842470.
Fold/Unfold
B4GALT4; B4Gal T4; B4Gal-T4; Beta 1 4 galactosyltransferase 4; Beta 1 4 GalTase 4; Beta N acetylglucosaminyl glycolipid beta 1 4 galactosyltransferase 4; beta-1,4-galactosyltransferase 4; beta-1,4-GalTase 4; beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 4; Beta4Gal T4; beta4Gal-T4; EC 2.4.1.-; UDP Gal:betaGlcNAc beta ,4 galactosyltransferase 4; UDP Gal:betaGlcNAc beta 1 4 galactosyltransferase polypeptide 4; UDP galactose:beta N acetylglucosamine beta 1 4 galactosyltransferase 4; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 4; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 4; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 4;
Immunogens
High expression in heart, placenta, kidney and pancreas; lower in brain, colon, lung, muscle, ovary, testis and uterus.
- O60513 B4GT4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGFNLTFHLSYKFRLLLLLTLCLTVVGWATSNYFVGAIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O60513 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S88 | Phosphorylation | Uniprot | |
Y155 | Phosphorylation | Uniprot | |
Y158 | Phosphorylation | Uniprot | |
Y178 | Phosphorylation | Uniprot |
Research Backgrounds
Responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids.
Golgi apparatus>Golgi stack membrane>Single-pass type II membrane protein.
Note: Trans cisternae of Golgi stack.
High expression in heart, placenta, kidney and pancreas; lower in brain, colon, lung, muscle, ovary, testis and uterus.
Belongs to the glycosyltransferase 7 family.
Research Fields
· Metabolism > Glycan biosynthesis and metabolism > Glycosaminoglycan biosynthesis - keratan sulfate.
· Metabolism > Glycan biosynthesis and metabolism > Glycosphingolipid biosynthesis - lacto and neolacto series.
· Metabolism > Global and overview maps > Metabolic pathways.
References
Application: WB Species: Human Sample: HCC cell
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.