B3GALT5 Antibody - #DF9270
| Product: | B3GALT5 Antibody |
| Catalog: | DF9270 |
| Description: | Rabbit polyclonal antibody to B3GALT5 |
| Application: | WB |
| Reactivity: | Human |
| Mol.Wt.: | 36 kDa; 36kD(Calculated). |
| Uniprot: | Q9Y2C3 |
| RRID: | AB_2842466 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9270, RRID:AB_2842466.
Fold/Unfold
3-galactosyltransferase 5; 3-GalTase 5; b3Gal-T5; B3GalT-V; B3GALT5; B3GalTx; B3GT5_HUMAN; B3T5; Beta-1; Beta-1,3-Gal Tase 5; Beta-1,3-galactosyltransferase 5; beta-1,3-GalTase 5; beta-3-galactosyltransferase 5; Beta-3-Gx-T5; Beta3Gal-T5; Beta3GalT5; GLCT5; Homolog of C. elegans Bt toxin resistance gene bre-5; UDP-Gal:beta-GlcNAc beta-1; UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 5; UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5; UDP-galactose:beta-N-acetylglucosamine beta-1; UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 5;
Immunogens
Expressed in stomach, jejunum, colon, pancreas, small intestine, testis and gastrointestinal and pancreatic cancer cell lines. Hardly detected in lung, liver, adrenal gland and peripheral blood leukocytes.
- Q9Y2C3 B3GT5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAFPKMRLMYICLLVLGALCLYFSMYSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRRIVACHFIKPRTLLDYWQALENSRGEDCPPV
PTMs - Q9Y2C3 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T99 | Phosphorylation | Uniprot | |
| S101 | Phosphorylation | Uniprot |
Research Backgrounds
Catalyzes the transfer of Gal to GlcNAc-based acceptors with a preference for the core3 O-linked glycan GlcNAc(beta1,3)GalNAc structure. Can use glycolipid LC3Cer as an efficient acceptor.
Golgi apparatus membrane>Single-pass type II membrane protein.
Expressed in stomach, jejunum, colon, pancreas, small intestine, testis and gastrointestinal and pancreatic cancer cell lines. Hardly detected in lung, liver, adrenal gland and peripheral blood leukocytes.
Belongs to the glycosyltransferase 31 family.
Research Fields
· Metabolism > Glycan biosynthesis and metabolism > Glycosphingolipid biosynthesis - lacto and neolacto series.
· Metabolism > Glycan biosynthesis and metabolism > Glycosphingolipid biosynthesis - globo and isoglobo series.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.