Product: MT-ATP6 Antibody
Catalog: DF9237
Description: Rabbit polyclonal antibody to MT-ATP6
Application: WB IF/ICC
Cited expt.: WB
Reactivity: Human, Rat
Mol.Wt.: 25 kDa; 25kD(Calculated).
Uniprot: P00846
RRID: AB_2842433

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Rat
Clonality:
Polyclonal
Specificity:
MT-ATP6 Antibody detects endogenous levels of total MT-ATP6.
RRID:
AB_2842433
Cite Format: Affinity Biosciences Cat# DF9237, RRID:AB_2842433.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

ATP synthase subunit a; ATP6; ATP6_HUMAN; ATPASE6; F-ATPase protein 6; MT-ATP6; MTATP6;

Immunogens

Immunogen:

A synthesized peptide derived from human MT-ATP6, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Sequence:
MNENLFASFIAPTILGLPAAVLIILFPPLLIPTSKYLINNRLITTQQWLIKLTSKQMMTMHNTKGRTWSLMLVSLIIFIATTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGTVIMGFRSKIKNALAHFLPQGTPTPLIPMLVIIETISLLIQPMALAVRLTANITAGHLLMHLIGSATLAMSTINLPSTLIIFTILILLTILEIAVALIQAYVFTLLVSLYLHDNT

Research Backgrounds

Function:

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Subcellular Location:

Mitochondrion inner membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the ATPase A chain family.

Research Fields

· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.

· Human Diseases > Neurodegenerative diseases > Parkinson's disease.

· Human Diseases > Neurodegenerative diseases > Huntington's disease.

· Metabolism > Energy metabolism > Oxidative phosphorylation.

· Metabolism > Global and overview maps > Metabolic pathways.

References

1). CHCHD2 Thr61Ile mutation impairs F1F0-ATPase assembly in in vitro and in vivo models of Parkinson’s disease. Neural Regeneration Research, 2024 (PubMed: 37488867) [IF=5.9]

Application: WB    Species: Human    Sample: SH-SY5Y cells

Figure 4 CHCHD2 promotes F1F0-ATPase assembly in SH-SY5Y cells treated with MPP+.Flag-vector: LV-Flag-vector (Ubi-MCS-3FLAG-SV40-puromycin vector)-transfected SH-SY5Y cells; CHCHD2-Flag: LV-CHCHD2-Flag–transfected SH-SY5Y cells; CHCHD2-T61I: LV-CHCHD2-T61I-Flag-transfected SH-SY5Y cells; untreated: cells cultured in MEM-F12 medium; MPP+-treated: cells cultured with MPP+ (500 μM for 24 hours). (A) Representative western blots of ATP5A1, ATP6, VDAC1, and α-tubulin in the cytoplasm and mitochondrial membrane fractions without MPP+ treatment. (B) The ratio of ATP5A1 in the mitochondrial membrane and cytoplasmic fractions of control cells. (C) The ratio of ATP6 in the mitochondrial membrane and cytoplasmic fractions of control cells. (D) Representative western blots of ATP5A1, ATP6, and β-actin in whole-cell lysates from cells without MPP+ treatment. (E) Quantification of ATP5A1 and ATP6 expression in whole-cell lysates of control cells. (F) Representative western blots of ATP5A1, ATP6, VDAC1, and α-tubulin in the cytoplasmic and mitochondrial membrane fractions of cells treated with MPP+. (G) The ratio of ATP5A1 in the mitochondrial membrane and cytoplasmic fractions of MPP+-treated cells. (H) The ratio of ATP6 in the mitochondrial membrane and cytoplasmic fractions of MPP+-treated cells. (I) Representative western blots of ATP5A1, ATP6, and β-actin in whole-cell lysates of cells treated with MPP+. (J) The relative expression levels of ATP5A1 and ATP6 in whole-cell lysates of MPP+-treated cells. Data are expressed as the mean ± SD (n = 3 independent experiments). **P < 0.01, ***P < 0.001, ****P < 0.0001 (one-way analysis of variance followed by Tukey’s post hoc test). Mito-mem: Mitochondrial membrane; MPP+: 1-methyl-4-phenylpyridinium; VDAC1: voltage-dependent anion-selective channel protein 1.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.