ARSB Antibody - #DF9227
Product: | ARSB Antibody |
Catalog: | DF9227 |
Description: | Rabbit polyclonal antibody to ARSB |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Dog, Chicken |
Mol.Wt.: | 60 kDa; 60kD(Calculated). |
Uniprot: | P15848 |
RRID: | AB_2842423 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9227, RRID:AB_2842423.
Fold/Unfold
Arsb; ARSB_HUMAN; Arylsulfatase B; ArylsulfataseB; ASB; G4S; MPS6; N acetylgalactosamine 4 sulfatase; N-acetylgalactosamine-4-sulfatase;
Immunogens
- P15848 ARSB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P15848 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T164 | Phosphorylation | Uniprot | |
Y165 | Phosphorylation | Uniprot | |
Y168 | Phosphorylation | Uniprot | |
S177 | Phosphorylation | Uniprot | |
T190 | Phosphorylation | Uniprot | |
T204 | Phosphorylation | Uniprot | |
S334 | Phosphorylation | Uniprot | |
N366 | N-Glycosylation | Uniprot | |
S417 | Phosphorylation | Uniprot | |
Y491 | Phosphorylation | Uniprot |
Research Backgrounds
Removes sulfate groups from chondroitin-4-sulfate (C4S) and regulates its degradation. Involved in the regulation of cell adhesion, cell migration and invasion in colonic epithelium. In the central nervous system, is a regulator of neurite outgrowth and neuronal plasticity, acting through the control of sulfate glycosaminoglycans and neurocan levels (By similarity).
The conversion to 3-oxoalanine (also known as C-formylglycine, FGly), of a serine or cysteine residue in prokaryotes and of a cysteine residue in eukaryotes, is critical for catalytic activity. This post-translational modification is severely defective in multiple sulfatase deficiency (MSD).
Lysosome. Cell surface.
Monomer.
Belongs to the sulfatase family.
Research Fields
· Cellular Processes > Transport and catabolism > Lysosome. (View pathway)
· Metabolism > Glycan biosynthesis and metabolism > Glycosaminoglycan degradation.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.