Product: SCNN1A Antibody
Catalog: DF9199
Description: Rabbit polyclonal antibody to SCNN1A
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 76kDa; 76kD(Calculated).
Uniprot: P37088
RRID: AB_2842395

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IHC 1:100-200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(92%), Horse(100%), Sheep(92%), Rabbit(100%), Dog(100%), Chicken(92%)
Clonality:
Polyclonal
Specificity:
SCNN1A Antibody detects endogenous levels of total SCNN1A.
RRID:
AB_2842395
Cite Format: Affinity Biosciences Cat# DF9199, RRID:AB_2842395.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Alpha ENaC 2; Alpha ENaC; Alpha NaCH; Alpha-ENaC; Alpha-NaCH; Amiloride sensitive epithelial sodium channel alpha subunit; Amiloride sensitive sodium channel subunit alpha; Amiloride-sensitive sodium channel subunit alpha; ENaCA; ENaCalpha; Epithelial Na(+) channel subunit alpha; Epithelial Na+ channel subunit alpha; FLJ21883; Nonvoltage gated sodium channel 1 subunit alpha; Nonvoltage-gated sodium channel 1 subunit alpha; SCNEA; SCNN 1; SCNN1; Scnn1a; SCNNA_HUMAN; Sodium channel nonvoltage gated 1 alpha;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P37088 SCNNA_HUMAN:

Expressed in the female reproductive tract, from the fimbrial end of the fallopian tube to the endometrium (at protein level) (PubMed:22207244). Expressed in kidney (at protein level). In the respiratory tract, expressed in the bronchial epithelium (at protein level). Highly expressed in lung. Detected at intermediate levels in pancreas and liver, and at low levels in heart and placenta (PubMed:22207244). in skin, expressed in keratinocytes, melanocytes and Merkel cells of the epidermal sub-layers, stratum basale, stratum spinosum and stratum granulosum (at protein level) (PubMed:28130590). Expressed in the outer root sheath of the hair follicles (at protein level) (PubMed:28130590). Detected in both peripheral and central cells of the sebaceous gland (at protein level) (PubMed:28130590). Expressed by eccrine sweat glands (at protein level) (PubMed:28130590). In skin, also expressed by arrector pili muscle cells and intradermal adipocytes (PubMed:28130590). Isoform 1 and isoform 2 predominate in all tissues. Expression of isoform 3, isoform 4 and isoform 5 is very low or not detectable, except in lung and heart (PubMed:9575806).

Sequence:
MEGNKLEEQDSSPPQSTPGLMKGNKREEQGLGPEPAAPQQPTAEEEALIEFHRSYRELFEFFCNNTTIHGAIRLVCSQHNRMKTAFWAVLWLCTFGMMYWQFGLLFGEYFSYPVSLNINLNSDKLVFPAVTICTLNPYRYPEIKEELEELDRITEQTLFDLYKYSSFTTLVAGSRSRRDLRGTLPHPLQRLRVPPPPHGARRARSVASSLRDNNPQVDWKDWKIGFQLCNQNKSDCFYQTYSSGVDAVREWYRFHYINILSRLPETLPSLEEDTLGNFIFACRFNQVSCNQANYSHFHHPMYGNCYTFNDKNNSNLWMSSMPGINNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPRPQNVEYCDYRKHSSWGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGYSRWPSVTSQEWVFQMLSRQNNYTVNNKRNGVAKVNIFFKELNYKTNSESPSVTMVTLLSNLGSQWSLWFGSSVLSVVEMAELVFDLLVIMFLMLLRRFRSRYWSPGRGGRGAQEVASTLASSPPSHFCPHPMSLSLSQPGPAPSPALTAPPPAYATLGPRPSPGGSAGASSSTCPLGGP

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Dog
100
Rabbit
100
Bovine
92
Sheep
92
Chicken
92
Xenopus
75
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P37088 As Substrate

Site PTM Type Enzyme
Ubiquitination
K22 Ubiquitination
T154 Phosphorylation
S174 Phosphorylation
K220 Ubiquitination
K233 Ubiquitination
T375 Phosphorylation
S376 Phosphorylation
S378 Phosphorylation
T383 Phosphorylation
K529 Ubiquitination
S594 Phosphorylation
T663 Phosphorylation

Research Backgrounds

Function:

Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Plays an essential role in electrolyte and blood pressure homeostasis, but also in airway surface liquid homeostasis, which is important for proper clearance of mucus. Controls the reabsorption of sodium in kidney, colon, lung and eccrine sweat glands. Also plays a role in taste perception.

PTMs:

Ubiquitinated; this targets individual subunits for endocytosis and proteasome-mediated degradation.

ENaC cleavage by furin, and subsequently by prostasin (PRSS8), leads to a stepwise increase in the open probability of the channel as a result of release of the alpha and gamma subunit inhibitory tracts, respectively. Interaction of ENaC subunit SCNN1B with BPIFA1 protects ENaC against proteolytic activation.

N-glycosylated.

Subcellular Location:

Apical cell membrane>Multi-pass membrane protein. Cell projection>Cilium. Cytoplasmic granule. Cytoplasm. Cytoplasmic vesicle>Secretory vesicle>Acrosome. Cell projection>Cilium>Flagellum.
Note: In the oviduct and bronchus, located on cilia in multi-ciliated cells. In endometrial non-ciliated epithelial cells, restricted to apical surfaces. In epidermis, located nearly uniformly in the cytoplasm in a granular distribution (PubMed:28130590). In sebaceous glands, observed only in the cytoplasmic space in between the lipid vesicles (PubMed:28130590). In eccrine sweat glands, mainly located at the apical surface of the cells facing the lumen (PubMed:28130590). In skin, in arrector pili muscle cells and in adipocytes, located in the cytoplasm and colocalized with actin fibers (PubMed:28130590). In spermatogonia, spermatocytes and round spermatids, located in the cytoplasm (By similarity). Prior to spermiation, location shifts from the cytoplasm to the spermatid tail (By similarity). In spermatozoa, localizes at the acrosome and the central region of the sperm flagellum (By similarity).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in the female reproductive tract, from the fimbrial end of the fallopian tube to the endometrium (at protein level). Expressed in kidney (at protein level). In the respiratory tract, expressed in the bronchial epithelium (at protein level). Highly expressed in lung. Detected at intermediate levels in pancreas and liver, and at low levels in heart and placenta. in skin, expressed in keratinocytes, melanocytes and Merkel cells of the epidermal sub-layers, stratum basale, stratum spinosum and stratum granulosum (at protein level). Expressed in the outer root sheath of the hair follicles (at protein level). Detected in both peripheral and central cells of the sebaceous gland (at protein level). Expressed by eccrine sweat glands (at protein level). In skin, also expressed by arrector pili muscle cells and intradermal adipocytes. Isoform 1 and isoform 2 predominate in all tissues. Expression of isoform 3, isoform 4 and isoform 5 is very low or not detectable, except in lung and heart.

Subunit Structure:

Heterotrimer containing an alpha/SCNN1A, a beta/SCNN1B and a gamma/SCNN1G subunit. An additional delta/SCNN1D subunit exists only in some organisms and can replace the alpha/SCNN1A subunit to form an alternative channel with specific properties (By similarity). Interacts with NEDD4 (via WW domains). Interacts with NEDD4L (via WW domains). Interacts with WWP1 (via WW domains). Interacts with WWP2 (via WW domains). Interacts with the full-length immature form of PCSK9 (pro-PCSK9).

Family&Domains:

Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1A subfamily.

Research Fields

· Organismal Systems > Sensory system > Taste transduction.

· Organismal Systems > Excretory system > Aldosterone-regulated sodium reabsorption.

References

1). Renal lysophospholipase A1 contributes to Enterococcus faecalis-induced hypertension by enhancing sodium reabsorption. iScience, 2022 (PubMed: 36419851) [IF=5.8]

Application: WB    Species: Mouse    Sample: renal medulla

Figure 2 Effects of renal lypla1 knockdown on blood pressure and sodium reabsorption in E. faecalis-treated mice (A) Expression of LYPLA1 in the renal medulla (n = 6 per group). (B) SBP and DBP (n = 6 per group). (C) Serum Ang II content (n = 6 per group). (D) Urinary sodium excretion (n = 6 per group). (E) Urine volume (n = 6 per group). (F) Representative immunoblots of αENaC and summarized intensities of blots in the renal medulla (n = 6 per group). Data are presented as mean ± SE. ∗p < 0.05, ∗∗p < 0.01; $ p < 0.05, $$ p < 0.01 VS other groups; ns, no significance. (G) Urinary sodium excretion (n = 6 per group). (H) Representative immunoblots of αENaC and summarized intensities of blots in the renal medulla (n = 6 per group). Data are presented as mean ± SE. ∗p < 0.05, ∗∗p < 0.01; $ p < 0.05, $$ p < 0.01 VS other groups; ns, no significance.

2). Sodium butyrate ameliorates deoxycorticosterone acetate/salt-induced hypertension and renal damage by inhibiting the MR/SGK1 pathway. HYPERTENSION RESEARCH, 2021 (PubMed: 32908237) [IF=5.4]

Application: WB    Species: rat    Sample: renal cortex and medulla

Fig. 4 |Effects of NaBu on DOCA/salt-induced renal sodium transporter proteins.Representative immunoblots of α-ENaC, β-ENaC, γ-ENaC,NHE3, NCC, and NKCC-2 and summarized intensities of blots in the renal cortex (a) and medulla (b) (n = 6–7 per group).αENaC α-subunit of epithelial sodium channel, β-ENaC βsubunit of epithelial sodium channel, γ-ENaC γ-subunit of epithelial sodium channel,NHE3 sodium/proton exchanger isoform 3, NKCC-2 Na-K-2Cl cotransporter, NCC Na-Cl Cotransporter

3). Stool-Softening Effect and Action Mechanism of Free Anthraquinones Extracted from Rheum Palmatum L. On Water Deficit-Induced Constipation in Rats. Journal of ethnopharmacology, 2024 (PubMed: 37907143) [IF=5.4]

Application: WB    Species: Rat    Sample: colon

Fig. 11. Exposed protein bands (A) and grayscale ratios of VIP (B1), CAP1 (B2), PKA (B3), CFTR (B4), NHE3 (B5), ENaC (B6), AQP3 (B7), AQP4 (B8), and AQP8 (B9) protein expression in the colon of each group. # P < 0.05, ## P < 0.01 vs. Nor group; * P < 0.05, * * P < 0.01 vs. Mod group.

4). Single-walled carbon nanohorn aggregates promotes mitochondrial dysfunction-induced apoptosis in hepatoblastoma cells by targeting SIRT3. INTERNATIONAL JOURNAL OF ONCOLOGY, 2018 (PubMed: 29956732) [IF=5.2]

Application: WB    Species: mouse    Sample: HepG2 xenografts

Figure 4.| Treatment with SWNHs alters the expression of mitochondrial apoptosis pathway-associated proteins in vivo. HepG2 xenografts in nude mice were regularly treated with SWNHs. The changes in expression and relative quantification of mitochondrial apoptosis pathway-associated proteins that were induced by SWNHs as detected by western blotting in HepG2 xenografts. Data are presented as the mean ± standard deviation (n=3). P<0.05 compared with the control group. AceCS2, acyl-CoA synthetase short chain family member 1; SCNN1A, sodium channel epithelial 1α subunit; SIRT3, sirtuin 3; SWNH, single-walled carbon nanohorn; VDAC1, voltage‑dependent anion channel 1

5). The mechanism underlying fluoride-induced low-renin hypertension is related to an imbalance in the circulatory and local renin-angiotensin systems. Toxicology Letters, 2023 (PubMed: 37105417) [IF=3.5]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.