ASAH3 Antibody - #DF9192
| Product: | ASAH3 Antibody |
| Catalog: | DF9192 |
| Description: | Rabbit polyclonal antibody to ASAH3 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Sheep, Rabbit, Dog |
| Mol.Wt.: | 31 kDa; 31kD(Calculated). |
| Uniprot: | Q8TDN7 |
| RRID: | AB_2842388 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9192, RRID:AB_2842388.
Fold/Unfold
Acer1; ACER1_HUMAN; Acylsphingosine deacylase 3; Alkaline CDase 1; Alkaline ceramidase 1; Alkaline ceramidase; AlkCDase 1; ALKCDase1; ASAH 3; MGC138327; MGC138329; N acylsphingosine amidohydrolase (alkaline ceramidase) 3; N acylsphingosine amidohydrolase 3 alkaline ceramidase; N acylsphingosine amidohydrolase 3; N-acylsphingosine amidohydrolase 3;
Immunogens
- Q8TDN7 ACER1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPSIFAYQSSEVDWCESNFQYSELVAEFYNTFSNIPFFIFGPLMMLLMHPYAQKRSRYIYVVWVLFMIIGLFSMYFHMTLSFLGQLLDEIAILWLLGSGYSIWMPRCYFPSFLGGNRSQFIRLVFITTVVSTLLSFLRPTVNAYALNSIALHILYIVCQEYRKTSNKELRHLIEVSVVLWAVALTSWISDRLLCSFWQRIHFFYLHSIWHVLISITFPYGMVTMALVDANYEMPGETLKVRYWPRDSWPVGLPYVEIRGDDKDC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Endoplasmic reticulum ceramidase that catalyzes the hydrolysis of ceramides into sphingosine and free fatty acids at alkaline pH. Ceramides, sphingosine, and its phosphorylated form sphingosine-1-phosphate are bioactive lipids that mediate cellular signaling pathways regulating several biological processes including cell proliferation, apoptosis and differentiation. Exhibits a strong substrate specificity towards the natural stereoisomer of ceramides with D-erythro-sphingosine as a backbone and has a higher activity towards very long-chain unsaturated fatty acids like the C24:1-ceramide. May also hydrolyze dihydroceramides to produce dihydrosphingosine. ACER1 is a skin-specific ceramidase that regulates the levels of ceramides, sphingosine and sphingosine-1-phosphate in the epidermis, mediates the calcium-induced differentiation of epidermal keratinocytes and more generally plays an important role in skin homeostasis.
Endoplasmic reticulum membrane>Multi-pass membrane protein.
Mainly expressed in epidermis.
Belongs to the alkaline ceramidase family.
Research Fields
· Environmental Information Processing > Signal transduction > Sphingolipid signaling pathway. (View pathway)
· Metabolism > Lipid metabolism > Sphingolipid metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.