AKR1C1 Antibody - #DF9189

(4)  
Product: AKR1C1 Antibody
Catalog: DF9189
Description: Rabbit polyclonal antibody to AKR1C1
Application: WB IHC IF/ICC
Reactivity: Human, Monkey
Mol.Wt.: 37 kDa; 37kD(Calculated).
Uniprot: Q04828
RRID: AB_2842385

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
IF/ICC 1:100-1:500, WB 1:1000-3000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Monkey
Clonality:
Polyclonal
Specificity:
AKR1C1 Antibody detects endogenous levels of total AKR1C1.
RRID:
AB_2842385
Cite Format: Affinity Biosciences Cat# DF9189, RRID:AB_2842385.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

2-dihydrobenzene-1; 2-diol dehydrogenase; 20 alpha (3 alpha) hydroxysteroid dehydrogenase; 20 ALPHA HSD; 20 alpha hydroxysteroid dehydrogenase; 20-alpha-HSD; 20-alpha-hydroxysteroid dehydrogenase; 20ALPHAHSD; 2ALPHAHSD; AK1C1; AK1C1_HUMAN; AKR1C1; Aldo keto reductase family 1 member C1; aldo-keto reductase C; Aldo-keto reductase family 1 member C1; Aldo-keto reductase family, 1 member 1; C9; Chlordecone reductase homolog; Chlordecone reductase homolog HAKRC; DD1; DD1/DD2; DDH; DDH1; Dihydrodiol dehydrogenase 1; Dihydrodiol dehydrogenase 1/2; dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase; dihydrodiol dehydrogenase isoform DD1; Dihydrodiol dehydrogenase, type 1; H37; HAKRC; HBAB; Hepatic dihydrodiol dehydrogenase; High affinity hepatic bile acid-binding protein; High-affinity hepatic bile acid-binding protein; Indanol dehydrogenase; MBAB; MGC8954; Trans-1; Trans-1,2 dihydrobenzene 1,2 diol dehydrogenase; Type II 3 alpha hydroxysteroid dehydrogenase;

Immunogens

Immunogen:
Uniprot:

Q04828(AK1C1_HUMAN) >>Visit HPA database.

Gene(ID):
AKR1C1(1645)
Expression:
Q04828 AK1C1_HUMAN:

Expressed in all tissues tested including liver, prostate, testis, adrenal gland, brain, uterus, mammary gland and keratinocytes. Highest levels found in liver, mammary gland and brain.

Sequence:
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY

PTMs - Q04828 As Substrate

Site PTM Type Enzyme
K4 Acetylation
K4 Sumoylation
K4 Ubiquitination
Y5 Phosphorylation
K9 Sumoylation
K9 Ubiquitination
T23 Phosphorylation
Y24 Phosphorylation
K31 Ubiquitination
S32 Phosphorylation
K33 Ubiquitination
T38 Phosphorylation
K39 Ubiquitination
S51 Phosphorylation
Y55 Phosphorylation
S67 Phosphorylation
K68 Ubiquitination
S73 Phosphorylation
K75 Acetylation
K75 Sumoylation
K75 Ubiquitination
Y81 Phosphorylation
T82 Phosphorylation
S83 Phosphorylation
K84 Ubiquitination
K104 Sumoylation
K104 Ubiquitination
Y110 Phosphorylation
K123 Ubiquitination
K131 Sumoylation
T141 Phosphorylation
K161 Ubiquitination
S162 Phosphorylation
S166 Phosphorylation
K179 Ubiquitination
K183 Ubiquitination
Y184 Phosphorylation
K185 Ubiquitination
Y196 Phosphorylation
K201 Ubiquitination
K207 Ubiquitination
S208 Phosphorylation
K209 Ubiquitination
S232 Phosphorylation
K246 Acetylation
K246 Ubiquitination
K247 Acetylation
K247 Ubiquitination
K270 Acetylation
K270 Ubiquitination
Y272 Phosphorylation
K294 Ubiquitination
Y305 Phosphorylation
Y317 Phosphorylation

Research Backgrounds

Function:

Converts progesterone to its inactive form, 20-alpha-dihydroxyprogesterone (20-alpha-OHP). In the liver and intestine, may have a role in the transport of bile. May have a role in monitoring the intrahepatic bile acid concentration. Has a low bile-binding ability. May play a role in myelin formation.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in all tissues tested including liver, prostate, testis, adrenal gland, brain, uterus, mammary gland and keratinocytes. Highest levels found in liver, mammary gland and brain.

Subunit Structure:

Monomer.

Family&Domains:

Belongs to the aldo/keto reductase family.

Research Fields

· Metabolism > Lipid metabolism > Steroid hormone biosynthesis.

· Metabolism > Xenobiotics biodegradation and metabolism > Metabolism of xenobiotics by cytochrome P450.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.