ALDH3B2 Antibody - #DF9188
Product: | ALDH3B2 Antibody |
Catalog: | DF9188 |
Description: | Rabbit polyclonal antibody to ALDH3B2 |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Prediction: | Zebrafish, Horse, Dog |
Mol.Wt.: | 43 kDa; 43kD(Calculated). |
Uniprot: | P48448 |
RRID: | AB_2842384 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9188, RRID:AB_2842384.
Fold/Unfold
Acetaldehyde dehydrogenase 8; AL3B2_HUMAN; Aldehyde dehydrogenase 3 family, member B2; Aldehyde dehydrogenase 8; Aldehyde dehydrogenase family 3 member B2; ALDH3B2; ALDH8; OTTHUMP00000235616;
Immunogens
- P48448 AL3B2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKDEPRSTNLFMKLDSVFIWKEPFGLVLIIAPWNYPLNLTLVLLVGALAAGSCVVLKPSEISQGTEKVLAEVLPQYLDQSCFAVVLGGPQETGQLLEHKLDYIFFTGSPRVGKIVMTAATKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFCYFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSPNLGHIINQKQFQRLRALLGCSRVAIGGQSNESDRYIAPTVLVDVQETEPVMQEEIFGPILPIVNVQSVDEAIKFINRQEKPLALYAFSNSSQVVNQMLERTSSGSFGGNEGFTYISLLSVPFGGVGHSGMGRYHGKFTFDTFSHHRTCLLAPSGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P48448 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T117 | Phosphorylation | Uniprot | |
T124 | Phosphorylation | Uniprot | |
T127 | Phosphorylation | Uniprot | |
K133 | Ubiquitination | Uniprot | |
K208 | Ubiquitination | Uniprot | |
Y362 | Phosphorylation | Uniprot | |
Y365 | Phosphorylation | Uniprot |
Research Backgrounds
Oxidizes medium and long chain aldehydes into non-toxic fatty acids.
Geranylgeranylation is important for localization to lipid droplets and enzyme activity.
Lipid droplet.
Salivary gland.
Belongs to the aldehyde dehydrogenase family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.