C9orf23 Antibody - #DF9186
Product: | C9orf23 Antibody |
Catalog: | DF9186 |
Description: | Rabbit polyclonal antibody to C9orf23 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Bovine, Horse, Sheep, Dog |
Mol.Wt.: | 18 kDa; 18kD(Calculated). |
Uniprot: | Q8N5L8 |
RRID: | AB_2842382 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9186, RRID:AB_2842382.
Fold/Unfold
Alba like protein C9orf23; bA296L22.5; C9orf23; MGC29635; Ribonuclease P protein subunit p25 like protein; Ribonuclease P/MRP 25kDa subunit like; RNase P protein subunit like p25; Rpp25 like protein; RPP25L;
Immunogens
- Q8N5L8 RP25L_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q8N5L8 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S16 | Phosphorylation | Uniprot | |
T25 | Phosphorylation | Uniprot | |
K86 | Ubiquitination | Uniprot | |
S100 | Phosphorylation | Uniprot | |
S122 | Phosphorylation | Uniprot |
Research Backgrounds
May be a component of ribonuclease P or MRP.
Nucleus.
Belongs to the histone-like Alba family.
Research Fields
· Genetic Information Processing > Translation > Ribosome biogenesis in eukaryotes.
· Genetic Information Processing > Translation > RNA transport.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.