RPS4Y1/2 Antibody - #DF9124
Product: | RPS4Y1/2 Antibody |
Catalog: | DF9124 |
Description: | Rabbit polyclonal antibody to RPS4Y1/2 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 29 kDa; 29kD(Calculated). |
Uniprot: | Q8TD47 | P22090 |
RRID: | AB_2842320 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9124, RRID:AB_2842320.
Fold/Unfold
40S ribosomal protein S4, Y isoform 2; RPS4Y2; RPS4Y2P; 40S ribosomal protein S4; 40S ribosomal protein S4, Y; 40S ribosomal protein S4, Y isoform 1; MGC119100; MGC5070; ribosomal protein S4, Y linked 1; ribosomal protein S4, Y linked; ribosomal protein S4, Y-linked 1; ribosomal protein S4Y; RPS4Y; RPS4Y1; RS4Y1_HUMAN; S4; Y isoform 1;
Immunogens
- Q8TD47 RS4Y2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQHFLKIDGKVRVDITYPAGFIDVISIEKTGEHFRLVYNTKGCFAVHRITVEEAKYKLCKVRKITVGTKGIPHLVTHDARTIRYPDPLIKVNDTVQIDLGTGKITSFIKFDTGNVCMVIAGANLGRVGVITNRERHPGSCDVVHVKDANGNSFATRISNIFVIGNGNKPWISLPRGKGIRLTIAEERDKRLAAKQSSG
- P22090 RS4Y1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLATKQSSG
PTMs - Q8TD47/P22090 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K7 | Methylation | Uniprot | |
K16 | Acetylation | Uniprot | |
K16 | Ubiquitination | Uniprot | |
K22 | Acetylation | Uniprot | |
K22 | Ubiquitination | Uniprot | |
T24 | Phosphorylation | Uniprot | |
S32 | Phosphorylation | Uniprot | |
T33 | Phosphorylation | Uniprot | |
K37 | Ubiquitination | Uniprot | |
K53 | Acetylation | Uniprot | |
K53 | Methylation | Uniprot | |
K53 | Ubiquitination | Uniprot | |
Y54 | Phosphorylation | Uniprot | |
T57 | Phosphorylation | Uniprot | |
K62 | Acetylation | Uniprot | |
K62 | Ubiquitination | Uniprot | |
K63 | Ubiquitination | Uniprot | |
K71 | Ubiquitination | Uniprot | |
K75 | Ubiquitination | Uniprot | |
K106 | Ubiquitination | Uniprot | |
K125 | Ubiquitination | Uniprot | |
K134 | Ubiquitination | Uniprot | |
R145 | Methylation | Uniprot | |
K155 | Methylation | Uniprot | |
K168 | Ubiquitination | Uniprot | |
R200 | Methylation | Uniprot | |
S204 | Phosphorylation | Uniprot | |
K211 | Ubiquitination | Uniprot | |
K233 | Acetylation | Uniprot | |
K233 | Ubiquitination | Uniprot | |
S237 | Phosphorylation | Uniprot |
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K7 | Methylation | Uniprot | |
K16 | Acetylation | Uniprot | |
K16 | Ubiquitination | Uniprot | |
K22 | Acetylation | Uniprot | |
K22 | Ubiquitination | Uniprot | |
T24 | Phosphorylation | Uniprot | |
S32 | Phosphorylation | Uniprot | |
T33 | Phosphorylation | Uniprot | |
K37 | Ubiquitination | Uniprot | |
K53 | Acetylation | Uniprot | |
K53 | Methylation | Uniprot | |
K53 | Ubiquitination | Uniprot | |
Y54 | Phosphorylation | Uniprot | |
T57 | Phosphorylation | Uniprot | |
K62 | Acetylation | Uniprot | |
K62 | Ubiquitination | Uniprot | |
K63 | Ubiquitination | Uniprot | |
K75 | Ubiquitination | Uniprot | |
S91 | Phosphorylation | Uniprot | |
K125 | Ubiquitination | Uniprot | |
T130 | Phosphorylation | Uniprot | |
R145 | Methylation | Uniprot | |
R148 | Methylation | Uniprot | |
K233 | Acetylation | Uniprot | |
K233 | Ubiquitination | Uniprot | |
S237 | Phosphorylation | Uniprot | |
K259 | Ubiquitination | Uniprot |
Research Backgrounds
Belongs to the eukaryotic ribosomal protein eS4 family.
Belongs to the eukaryotic ribosomal protein eS4 family.
Research Fields
· Genetic Information Processing > Translation > Ribosome.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.