MOGAT3 Antibody - #DF9099
| Product: | MOGAT3 Antibody |
| Catalog: | DF9099 |
| Description: | Rabbit polyclonal antibody to MOGAT3 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Rat |
| Prediction: | Dog |
| Mol.Wt.: | 39 kDa; 39kD(Calculated). |
| Uniprot: | Q86VF5 |
| RRID: | AB_2842295 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9099, RRID:AB_2842295.
Fold/Unfold
2 acylglycerol O acyltransferase 3; 2-acylglycerol O-acyltransferase 3; Acyl CoA:monoacylglycerol acyltransferase 3; Acyl coenzyme A:monoacylglycerol acyltransferase 3; Acyl-CoA:monoacylglycerol acyltransferase 3; DC 7; DC7; DGAT2L7; Diacylglycerol acyltransferase 2 like protein 7; Diacylglycerol acyltransferase 2-like protein 7; Diacylglycerol O acyltransferase candidate 7; Diacylglycerol O-acyltransferase candidate 7; hDC 7; hDC7; MGAT 3; MGAT3; MGC119203; MGC119204; MOGAT 3; MOGAT3; MOGT3_HUMAN; Monoacylglycerol O acyltransferase 3; Monoacylglycerol O-acyltransferase 3;
Immunogens
A synthesized peptide derived from human MOGAT3, corresponding to a region within C-terminal amino acids.
Selectively expressed in the digestive system. Highly expressed in the ileum, and at lower level in jejunum, duodenum, colon, cecum and the rectum. Not expressed in the stomach and the esophagus and trachea. Expressed at very low level in liver.
- Q86VF5 MOGT3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGVATTLQPPTTSKTLQKQHLEAVGAYQYVLTFLFMGPFFSLLVFVLLFTSLWPFSVFYLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDRNYVLGAHPHGIMCTGFLCNFSTESNGFSQLFPGLRPWLAVLAGLFYLPVYRDYIMSFGLCPVSRQSLDFILSQPQLGQAVVIMVGGAHEALYSVPGEHCLTLQKRKGFVRLALRHGASLVPVYSFGENDIFRLKAFATGSWQHWCQLTFKKLMGFSPCIFWGRGLFSATSWGLLPFAVPITTVVGRPIPVPQRLHPTEEEVNHYHALYMTALEQLFEEHKESCGVPASTCLTFI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. Also able to catalyze the terminal step in triacylglycerol synthesis by using diacylglycerol and fatty acyl-CoA as substrates. Has a preference toward palmitoyl-CoA and oleoyl-CoA. May be involved in absorption of dietary fat in the small intestine by catalyzing the resynthesis of triacylglycerol in enterocytes.
Ubiquitinated. Ubiquitination leads to proteasomal degradation.
Endoplasmic reticulum membrane>Multi-pass membrane protein. Cytoplasm>Perinuclear region.
Selectively expressed in the digestive system. Highly expressed in the ileum, and at lower level in jejunum, duodenum, colon, cecum and the rectum. Not expressed in the stomach and the esophagus and trachea. Expressed at very low level in liver.
Belongs to the diacylglycerol acyltransferase family.
Research Fields
· Metabolism > Lipid metabolism > Glycerolipid metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
· Organismal Systems > Digestive system > Fat digestion and absorption.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.