GZMA Antibody - #DF9054
![](/images/pubmed.gif)
Product: | GZMA Antibody |
Catalog: | DF9054 |
Description: | Rabbit polyclonal antibody to GZMA |
Application: | WB |
Reactivity: | Human |
Prediction: | Horse, Dog, Xenopus |
Mol.Wt.: | 28 kDa; 29kD(Calculated). |
Uniprot: | P12544 |
RRID: | AB_2842250 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9054, RRID:AB_2842250.
Fold/Unfold
CTL tryptase; CTLA3; Cytolytic t cell and natural killer cell specific trypsin like serine protease; Cytotoxic T lymphocyte associated serine esterase 3; Cytotoxic T lymphocyte proteinase 1; Cytotoxic T-lymphocyte proteinase 1; Fragmentin 1; Fragmentin-1; GRAA_HUMAN; Granzyme 1 cytotoxic T lymphocyte associated serine esterase 3; Granzyme A (Cytotoxic T lymphocyte associated serine esterase 3; Hanukah factor serine protease); Granzyme A (granzyme 1, cytotoxic T lymphocyte associated serine esterase 3); Granzyme A; Granzyme A precursor; Granzyme-1; GZMA; H factor; Hanukah factor serine protease; Hanukkah factor; HF; HFSP; TSP1;
Immunogens
- P12544 GRAA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRNSYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLMEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P12544 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K99 | Ubiquitination | Uniprot | |
N170 | N-Glycosylation | Uniprot | |
T257 | Phosphorylation | Uniprot |
Research Backgrounds
Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent cell death with morphological features of apoptosis when delivered into the target cell through the immunological synapse. It cleaves after Lys or Arg. Cleaves APEX1 after 'Lys-31' and destroys its oxidative repair activity. Cleaves the nucleosome assembly protein SET after 'Lys-189', which disrupts its nucleosome assembly activity and allows the SET complex to translocate into the nucleus to nick and degrade the DNA.
Secreted. Cytoplasmic granule.
Homodimer; disulfide-linked. Interacts with APEX1.
Belongs to the peptidase S1 family. Granzyme subfamily.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.