SYT2 Antibody - #DF9049
| Product: | SYT2 Antibody |
| Catalog: | DF9049 |
| Description: | Rabbit polyclonal antibody to SYT2 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Rabbit, Chicken |
| Mol.Wt.: | 47 kDa; 47kD(Calculated). |
| Uniprot: | Q8N9I0 |
| RRID: | AB_2842245 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9049, RRID:AB_2842245.
Fold/Unfold
Synaptotagmin 2; Synaptotagmin II; Synaptotagmin-2; Synaptotagmin2; SynaptotagminII; SYT 2; Syt II; Syt2; SYT2_HUMAN; SytII;
Immunogens
- Q8N9I0 SYT2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRNIFKRNQEPIVAPATTTATMPIGPVDNSTESGGAGESQEDMFAKLKEKLFNEINKIPLPPWALIAIAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q8N9I0 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K46 | Acetylation | Uniprot | |
| K48 | Acetylation | Uniprot | |
| K98 | Ubiquitination | Uniprot | |
| T122 | Phosphorylation | Uniprot | |
| T125 | Phosphorylation | Uniprot | |
| Y178 | Phosphorylation | Uniprot | |
| T199 | Phosphorylation | Q9H4A3 (WNK1) | Uniprot |
| K299 | Acetylation | Uniprot | |
| Y309 | Phosphorylation | Uniprot | |
| S378 | Phosphorylation | Uniprot | |
| T381 | Phosphorylation | Uniprot | |
| T383 | Phosphorylation | Q9H4A3 (WNK1) | Uniprot |
Research Backgrounds
Exhibits calcium-dependent phospholipid and inositol polyphosphate binding properties (By similarity). May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse (By similarity). Plays a role in dendrite formation by melanocytes.
Cytoplasmic vesicle>Secretory vesicle>Synaptic vesicle membrane>Single-pass membrane protein. Cytoplasmic vesicle>Secretory vesicle>Chromaffin granule membrane>Single-pass membrane protein.
Expressed in melanocytes.
Homotetramer (Probable). Interacts with STON2. Interacts with SCAMP5. Interacts with PRRT2 (By similarity).
The first C2 domain mediates Ca(2+)-dependent phospholipid binding.
The second C2 domain mediates interaction with Stonin 2. The second C2 domain mediates phospholipid and inositol polyphosphate binding in a calcium-independent manner.
Belongs to the synaptotagmin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.