CCNB2 Antibody - #DF9047
Product: | CCNB2 Antibody |
Catalog: | DF9047 |
Description: | Rabbit polyclonal antibody to CCNB2 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 45 kDa; 45kD(Calculated). |
Uniprot: | O95067 |
RRID: | AB_2842243 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9047, RRID:AB_2842243.
Fold/Unfold
ccnb2; CCNB2_HUMAN; CycB2; Cyclin B2; G2 mitotic specific cyclin B2; G2/mitotic specific cyclin B2; G2/mitotic-specific cyclin-B2; HsT17299; MGC108931; MGC140694;
Immunogens
- O95067 CCNB2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLIDYDMVHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKNVVKVNENLTKFIAIKNKYASSKLLKISMIPQLNSKAVKDLASPLIGRS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O95067 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T8 | Phosphorylation | Uniprot | |
S10 | Phosphorylation | Uniprot | |
S11 | Phosphorylation | Uniprot | |
T18 | Phosphorylation | Uniprot | |
S22 | Phosphorylation | Uniprot | |
K23 | Ubiquitination | Uniprot | |
K25 | Ubiquitination | Uniprot | |
K57 | Ubiquitination | Uniprot | |
K64 | Ubiquitination | Uniprot | |
K73 | Ubiquitination | Uniprot | |
S77 | Phosphorylation | Uniprot | |
K79 | Ubiquitination | Uniprot | |
K85 | Ubiquitination | Uniprot | |
S92 | Phosphorylation | Uniprot | |
T94 | Phosphorylation | Uniprot | |
S99 | Phosphorylation | Uniprot | |
K101 | Ubiquitination | Uniprot | |
S204 | Phosphorylation | Uniprot | |
S220 | Phosphorylation | Uniprot | |
K258 | Ubiquitination | Uniprot | |
S274 | Phosphorylation | Uniprot | |
K275 | Ubiquitination | Uniprot | |
Y298 | Phosphorylation | Uniprot | |
K318 | Ubiquitination | Uniprot | |
K324 | Ubiquitination | Uniprot | |
K328 | Ubiquitination | Uniprot | |
K349 | Ubiquitination | Uniprot | |
K353 | Ubiquitination | Uniprot | |
T359 | Phosphorylation | Uniprot | |
K360 | Ubiquitination | Uniprot | |
K367 | Ubiquitination | Uniprot | |
Y368 | Phosphorylation | Uniprot | |
K372 | Ubiquitination | Uniprot | |
K375 | Ubiquitination | Uniprot | |
K385 | Ubiquitination | Uniprot | |
K388 | Ubiquitination | Uniprot | |
S392 | Phosphorylation | Uniprot | |
S398 | Phosphorylation | Uniprot |
Research Backgrounds
Essential for the control of the cell cycle at the G2/M (mitosis) transition.
Interacts with the CDK1 protein kinase to form a serine/threonine kinase holoenzyme complex also known as maturation promoting factor (MPF). The cyclin subunit imparts substrate specificity to the complex.
Belongs to the cyclin family. Cyclin AB subfamily.
Research Fields
· Cellular Processes > Cell growth and death > Cell cycle. (View pathway)
· Cellular Processes > Cell growth and death > Oocyte meiosis. (View pathway)
· Cellular Processes > Cell growth and death > p53 signaling pathway. (View pathway)
· Cellular Processes > Cell growth and death > Cellular senescence. (View pathway)
· Environmental Information Processing > Signal transduction > FoxO signaling pathway. (View pathway)
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
· Organismal Systems > Endocrine system > Progesterone-mediated oocyte maturation.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.