TIAF1 Antibody - #DF9035
Product: | TIAF1 Antibody |
Catalog: | DF9035 |
Description: | Rabbit polyclonal antibody to TIAF1 |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Mol.Wt.: | 12 kDa; 12kD(Calculated). |
Uniprot: | O95411 |
RRID: | AB_2842231 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9035, RRID:AB_2842231.
Fold/Unfold
12 kDa TGF-beta-1-induced antiapoptotic factor; MAJN; MYO18A; MYSPDZ; SPR210; TGFB1 induced anti apoptotic factor 1; TGFB1 induced anti apoptotic factor 1 (12 kDa TGF beta1 induced antiapoptotic factor); TGFB1-induced anti-apoptotic factor 1; TIAF1; TIAF1_HUMAN;
Immunogens
Not detectable in normal kidney and liver. Up-regulated in chronic and acute allograft rejection: expressed in the inflammatory infiltrate and in tubular epithelial cells.
- O95411 TIAF1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG
Research Backgrounds
Inhibits the cytotoxic effects of TNF-alpha and overexpressed TNF receptor adapters TRADD, FADD, and RIPK1. Involved in TGF-beta1 inhibition of IkappaB-alpha expression and suppression of TNF-mediated IkappaB-alpha degradation.
Nucleus.
Not detectable in normal kidney and liver. Up-regulated in chronic and acute allograft rejection: expressed in the inflammatory infiltrate and in tubular epithelial cells.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.