MYL6B Antibody - #DF9022
Product: | MYL6B Antibody |
Catalog: | DF9022 |
Description: | Rabbit polyclonal antibody to MYL6B |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Dog |
Mol.Wt.: | 23 kDa; 23kD(Calculated). |
Uniprot: | P14649 |
RRID: | AB_2842218 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9022, RRID:AB_2842218.
Fold/Unfold
MLC1sa; MYL 6B; Myl6b; MYL6B_HUMAN; Myosin alkali light chain 1 slow a; Myosin light chain 1 slow a; Myosin light chain 1 slow twitch muscle A isoform; Myosin light chain 1 slow-twitch muscle A isoform; Myosin light chain 6B alkali smooth muscle and non muscle; Myosin light chain 6B; Myosin light polypeptide 6B alkali smooth muscle and non muscle; Myosin light polypeptide 6B; Smooth muscle and non muscle myosin alkali light chain 6B; Smooth muscle and nonmuscle myosin light chain alkali 6B;
Immunogens
- P14649 MYL6B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P14649 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S20 | Phosphorylation | Uniprot | |
R78 | Methylation | Uniprot | |
Y86 | Phosphorylation | Uniprot | |
S87 | Phosphorylation | Uniprot | |
T101 | Phosphorylation | Uniprot | |
K107 | Acetylation | Uniprot | |
K107 | Ubiquitination | Uniprot | |
S114 | Phosphorylation | Uniprot | |
Y146 | Phosphorylation | Uniprot |
Research Backgrounds
Regulatory light chain of myosin. Does not bind calcium.
Myosin is a hexamer of 2 heavy chains and 4 light chains.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Tight junction. (View pathway)
· Organismal Systems > Circulatory system > Vascular smooth muscle contraction. (View pathway)
· Organismal Systems > Endocrine system > Oxytocin signaling pathway.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.