MAGB4 Antibody - #DF9017

(2)  
Product: MAGB4 Antibody
Catalog: DF9017
Description: Rabbit polyclonal antibody to MAGB4
Application: WB IF/ICC
Reactivity: Human, Monkey
Mol.Wt.: 39kD,35kD(Calculated).
Uniprot: O15481 | P43366 | O15479 | Q96LZ2 | Q96M61
RRID: AB_2842213

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Monkey
Clonality:
Polyclonal
Specificity:
MAGB4 Antibody detects endogenous levels of total MAGB4.
RRID:
AB_2842213
Cite Format: Affinity Biosciences Cat# DF9017, RRID:AB_2842213.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

cancer/testis antigen family 3, member 6; CT3.6; MAGB4_HUMAN; MAGE B4 antigen; MAGE-B4 antigen; MAGEB4; melanoma antigen family B, 4; Melanoma associated antigen B4; Melanoma-associated antigen B4; MGC33144; Cancer/testis antigen 3.1; CT3.1; DAM10; DSS AHC critical interval MAGE superfamily 10; DSS-AHC critical interval MAGE superfamily 10; MAGB1_HUMAN; MAGE B1 antigen; MAGE Xp; MAGE-B1 antigen; MAGE-XP antigen; MAGEB1; MAGEL1; MAGEXP antigen; melanoma antigen family B, 1; Melanoma associated antigen B1; Melanoma-associated antigen B1; MGC9322; Cancer/testis antigen 3.2; Cancer/testis antigen family 3, member 2; CT3.2; DAM6; DSS AHC critical interval MAGE superfamily 6; DSS/AHC critical interval gene, from MAGE superfamily, 6; MAGE B2 antigen; MAGE XP 2; MAGE XP 2 antigen; Mage-b2; Mage-rs2; melanoma antigen family B, 2; Melanoma antigen, family B, 1; Melanoma associated antigen B2; MGC2643; MGC26438; Smage-2 protein; Smage2; FLJ32965; MAGBA_HUMAN; MAGE B10 antigen; MAGE family testis and tumor specific protein; MAGE-B10 antigen; MAGEB10; melanoma antigen family B, 10; Melanoma associated antigen B10; Melanoma-associated antigen B10; MGC120394; OTTHUMP00000043236; B430216B18Rik; MAGBI_HUMAN; MAGE-B18 antigen; MAGEB18; MAGEB18 antigen; Melanoma antigen family B, 18; Melanoma-associated antigen B18; MGC114496; RGD1560369; RP23-289C5.3;

Immunogens

Immunogen:
Uniprot:

O15481(MAGB4_HUMAN) >>Visit HPA database.

P43366(MAGB1_HUMAN) >>Visit HPA database.

O15479(MAGB2_HUMAN) >>Visit HPA database.

Q96LZ2(MAGBA_HUMAN) >>Visit HPA database.

Q96M61(MAGBI_HUMAN) >>Visit HPA database.

Gene(ID):
MAGEB10(139422) | MAGEB1(4112) | MAGEB18(286514) | MAGEB4(4115) | MAGEB2(4113)
Expression:
O15481 MAGB4_HUMAN:

Expressed in testis.

P43366 MAGB1_HUMAN:

Expressed only in testis.

O15479 MAGB2_HUMAN:

Expressed in testis and placenta, and in a significant fraction of tumors of various histologic types.

Sequence:
MPRGQKSKLRAREKRQRTRGQTQDLKVGQPTAAEKEESPSSSSSVLRDTASSSLAFGIPQEPQREPPTTSAAAAMSCTGSDKGDESQDEENASSSQASTSTERSLKDSLTRKTKMLVQFLLYKYKMKEPTTKAEMLKIISKKYKEHFPEIFRKVSQRTELVFGLALKEVNPTTHSYILVSMLGPNDGNQSSAWTLPRNGLLMPLLSVIFLNGNCAREEEIWEFLNMLGIYDGKRHLIFGEPRKLITQDLVQEKYLEYQQVPNSDPPRYQFLWGPRAHAETSKMKVLEFLAKVNDTTPNNFPLLYEEALRDEEERAGARPRVAARRGTTAMTSAYSRATSSSSSQPM

MPRGQKSKLRAREKRRKAREETQGLKVAHATAAEKEECPSSSPVLGDTPTSSPAAGIPQKPQGAPPTTTAAAAVSCTESDEGAKCQGEENASFSQATTSTESSVKDPVAWEAGMLMHFILRKYKMREPIMKADMLKVVDEKYKDHFTEILNGASRRLELVFGLDLKEDNPSGHTYTLVSKLNLTNDGNLSNDWDFPRNGLLMPLLGVIFLKGNSATEEEIWKFMNVLGAYDGEEHLIYGEPRKFITQDLVQEKYLKYEQVPNSDPPRYQFLWGPRAYAETTKMKVLEFLAKMNGATPRDFPSHYEEALRDEEERAQVRSSVRARRRTTATTFRARSRAPFSRSSHPM

MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAASSSPAAGIPQEPQRAPTTAAAAAAGVSSTKSKKGAKSHQGEKNASSSQASTSTKSPSEDPLTRKSGSLVQFLLYKYKIKKSVTKGEMLKIVGKRFREHFPEILKKASEGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFPRRKLLMPLLGVIFLNGNSATEEEIWEFLNMLGVYDGEEHSVFGEPWKLITKDLVQEKYLEYKQVPSSDPPRFQFLWGPRAYAETSKMKVLEFLAKVNGTTPCAFPTHYEEALKDEEKAGV

MPRGQKSKLRAREKRRQARGGLEDLIDALDILEEEEESPPSASACLKDVFQSSLDGASNNPHGLREAQSTSTSATAASHTRHPEGVNDQMEERPICTQDLEATDSFPRGPVDEKVIILVHYLLYKYQMKEPITKADMLRNVTQMSKSQFPVILSRASEHLELIFGLDLKEVEPNKHIYVLVNKLDLGCDAKLSDETGVPKTGLLMTVLGIIFTNGNCVAEEEVWKVFNTMGLYDGIEHFMFGEPRKLLTKDLVKENYLEYQQVPNSDPPRYQFLWGPRAHAETSKMKVLEFLAKVNDTAPSEFSNWYTEALQDEEERARARVAAKARVSATAGARSKVKSSKSSQLQ

MPRGQKSKLRAREKRHQARCENQDLGATQATVAEGESPSPAYLLFGDRPQNLPAAETPSIPEALQGAPSTTNAIAPVSCSSNEGASSQDEKSLGSSREAEGWKEDPLNKKVVSLVHFLLQKYETKEPITKGDMIKFVIRKDKCHFNEILKRASEHMELALGVDLKEVDPIRHYYAFFSKLDLTYDETTSDEEKIPKTGLLMIALGVIFLNGNRAPEEAVWEIMNMMGVYADRKHFLYGDPRKVMTKDLVQLKYLEYQQVPNSDPPRYEFLWGPRAHAETSKMKVLEFVAKIHDTVPSAFPSCYEEALRDEEQRTQARAAARAHTAAMANARSRTTSSSFSHAK

PTMs - O15481/P43366/O15479/Q96LZ2/Q96M61 As Substrate

Site PTM Type Enzyme
T183 Phosphorylation
S189 Phosphorylation
Y267 Phosphorylation
Site PTM Type Enzyme
T75 Phosphorylation
Y121 Phosphorylation
Y124 Phosphorylation
Y126 Phosphorylation
T133 Phosphorylation
S157 Phosphorylation
Y178 Phosphorylation
K287 Ubiquitination
T331 Phosphorylation
Site PTM Type Enzyme
S42 Phosphorylation
S44 Phosphorylation
S51 Phosphorylation
S53 Phosphorylation
S77 Phosphorylation
S78 Phosphorylation
K80 Ubiquitination
S81 Phosphorylation
K92 Ubiquitination
S95 Phosphorylation
K104 Ubiquitination
S105 Phosphorylation
K114 Ubiquitination
S117 Phosphorylation
Y124 Phosphorylation
S131 Phosphorylation
K134 Ubiquitination
K139 Ubiquitination
K154 Ubiquitination
K250 Ubiquitination
K256 Ubiquitination
K261 Ubiquitination
K285 Ubiquitination
K287 Ubiquitination
K294 Ubiquitination
K312 Acetylation
K312 Ubiquitination
K316 Ubiquitination
Site PTM Type Enzyme
S38 Phosphorylation
T69 Phosphorylation
S70 Phosphorylation
S86 Phosphorylation
T99 Phosphorylation
T101 Phosphorylation
Y122 Phosphorylation
T131 Phosphorylation
R242 Methylation
K284 Ubiquitination
Site PTM Type Enzyme
K136 Ubiquitination
K143 Ubiquitination
Y238 Phosphorylation
T246 Phosphorylation
K256 Ubiquitination
K284 Ubiquitination
S336 Phosphorylation

Research Backgrounds

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in testis.

Tissue Specificity:

Expressed only in testis.

Function:

May enhance ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex.

Tissue Specificity:

Expressed in testis and placenta, and in a significant fraction of tumors of various histologic types.

Subunit Structure:

Interacts with TRIM28.

Function:

May enhance ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Interacts with LNX1.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.