KRT3/6A/75/76 Antibody - #DF9009

(5)  
Product: KRT3/6A/75/76 Antibody
Catalog: DF9009
Description: Rabbit polyclonal antibody to KRT3/6A/75/76
Application: WB IHC IF/ICC
Reactivity: Human
Prediction: Horse, Dog
Mol.Wt.: 64 kDa; 66kD,64kD,60kD(Calculated).
Uniprot: Q01546 | P12035 | P02538 | O95678
RRID: AB_2842205

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
IHC 1:50-1:200, IF/ICC 1:100-1:500, WB 1:1000-3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Prediction:
Horse(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
KRT3/6A/75/76 Antibody detects endogenous levels of total KRT3/6A/75/76.
RRID:
AB_2842205
Cite Format: Affinity Biosciences Cat# DF9009, RRID:AB_2842205.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CK 2P; CK-2P; CK2P; Cytokeratin 2P; Cytokeratin-2P; Cytokeratin2; Cytokeratin2P; HUMCYT 2A; HUMCYT2A; K22O_HUMAN; K2P; K76; KB9; Keratin 2p; Keratin 76; Keratin 76, type II; Keratin; Keratin type II cytoskeletal 2 oral; Keratin-76; Keratin2p; Keratin76; KRT 2B; KRT 2P; KRT 76; KRT2B; KRT2P; KRT76; type II cytoskeletal 2 oral; Type-II keratin Kb9; 65 kDa cytokeratin; CK-3; CK3; Cytokeratin-3; K2C3_HUMAN; K3; Keratin 3; Keratin; Keratin type II cytoskeletal 3; Keratin-3; KRT3; type II cytoskeletal 3; Type-II keratin Kb3; CK 4; CK 5; CK 6A; CK 6B; CK 6C; CK 6D; CK 6E; CK4; CK5; CK6A; CK6B; CK6C; CK6D; CYK4; Cytokeratin 4; Cytokeratin 5; Cytokeratin 6A; Cytokeratin 6B; Cytokeratin 6C; Cytokeratin 6D; Cytokeratin 6E; DDD; K4; K5; K6A; K6a keratin; K6B; K6C; K6D; Keratin 5; Keratin 6A; Keratin 6B; Keratin 6C; Keratin 6D; Keratin 6E; Keratin K6h; Keratin, epidermal type II, K6A; Keratin, epidermal type II, K6C; Keratin, epidermal, type II, K6B; Keratin, type II cytoskeletal 4; Keratin, type II cytoskeletal 5; Keratin, type II cytoskeletal 6B; Keratin, type II cytoskeletal 6D; KRT5A; KRT6C; KRT6D; KRT6E; CK-75; CK75; Cytokeratin 75; Cytokeratin-75; hK6hf; K2C75_HUMAN; K6HF; K75; KB18; Keratin 6 hair follicle; Keratin 75; Keratin; Keratin type II cytoskeletal 75; Keratin-6 hair follicle; Keratin-75; Krt75; PFB; type II cytoskeletal 75; Type II keratin 18; Type II keratin-K6hf; Type-II keratin Kb18;

Immunogens

Immunogen:
Uniprot:

Q01546(K22O_HUMAN) >>Visit HPA database.

P12035(K2C3_HUMAN) >>Visit HPA database.

P02538(K2C6A_HUMAN) >>Visit HPA database.

O95678(K2C75_HUMAN) >>Visit HPA database.

Gene(ID):
KRT76(51350) | KRT3(3850) | KRT75(9119) | KRT6A(3853)
Expression:
P12035 K2C3_HUMAN:

Cornea specific.

P02538 K2C6A_HUMAN:

Constitutively expressed in distinct types of epithelia such as those in oral mucosa, esophagus, papillae of tongue and hair follicle outer root sheath.

O95678 K2C75_HUMAN:

Highly expressed in hair follicles from scalp. Specifically expressed in the of the hair companion layer follicle, a single layered band of flat and vertically oriented cells between the cuboidal outer root sheath (ORS) cells and the inner root sheath (IRS) that stretches from the lowermost bulb region to the isthmus of the follicle. Also expressed in medullated hairs. In nails, it is almost exclusively present in the nail bed (at protein level).

Sequence:
MNRQVCKKSFSGRSQGFSGRSAVVSGSSRMSCVARSGGAGGGACGFRSGAGSFGSRSLYNLGSNKSISISVAAGSSRAGGFGGGRSSCGFAGGYGGGFGGSYGGGFGGGRGVGSGFGGAGGFGGAGGFGGPGVFGGPGSFGGPGGFGPGGFPGGIQEVIVNQSLLQPLNVEIDPQIGQVKAQEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWELLQQQTTGSGPSSLEPCFESYISFLCKQLDSLLGERGNLEGELKSMQDLVEDFKKKYEDEINKRTAAENEFVGLKKDVDAAFMNKVELQAKVDSLTDEVSFLRTLYEMELSQMQSHASDTSVVLSMDNNRCLDLGSIIAEVRAQYEEIAQRSKSEAEALYQTKLGELQTTAGRHGDDLRNTKSEIMELNRMIQRLRAEIENVKKQNANLQTAIAEAEQRGEMALKDANAKLQDLQTALQKAKDDLARLLRDYQELMNVKLALDVEIATYRKLLEGEECRMSGECQSAVCISVVSNVTSTSGSSGSSRGVFGGVSGSGSGGYKGGSSSSSSSGYGVSGGSGSGYGGVSSGSTGGRGSSGSYQSSSSGSRLGGAGSISVSHSGMGSSSGSIQTSGGSGYKSGGGGSTSIRFSQTTSSSQHSSTK

MSRQASKTSGGGSQGFSGRSAVVSGSSRMSCVAHSGGAGGGAYGFRSGAGGFGSRSLYNLGGNKSISISVAAGGSRAGGFGGGRSSCAFAGGYGGGFGSGYGGGFGGGFGGGRGMGGGFGGAGGFGGAGGFGGAGGFGGPGGFGGSGGFGGPGSLGSPGGFGPGGFPGGIQEVTINQSLLQPLNVEIDPQIGQVKAQEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWNLLQQQGTSSISGTNNLEPLFENHINYLRSYLDNILGERGRLDSELKNMEDLVEDFKKKYEDEINKRTAAENEFVTLKKDVDSAYMNKVELQAKVDALIDEIDFLRTLYDAELSQMQSHISDTSVVLSMDNNRSLDLDSIIAEVRAQYEDIAQRSKAEAEALYQTKLGELQTTAGRHGDDLRNTKSEIIELNRMIQRLRAEIEGVKKQNANLQTAIAEAEQHGEMALKDANAKLQELQAALQQAKDDLARLLRDYQELMNVKLALDVEIATYRKLLEGEEYRMSGECPSAVSISVVSSSTTSASAGGYGGGYGGGMGGGLGGGFSAGGGSGSGFGRGGGGGIGGGFGGGSSGFSGGSGFGSISGARYGVSGGGFSSASNRGGSIKFSQSSQSSQRYSR

MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSVSVSRSRGSGGLGGACGGAGFGSRSLYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGFGFGGGAGIGFGLGGGAGLAGGFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPTIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRLDSELRGMQDLVEDFKNKYEDEINKRTAAENEFVTLKKDVDAAYMNKVELQAKADTLTDEINFLRALYDAELSQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRAEAESWYQTKYEELQVTAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQRGEMALKDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEGVGQVNISVVQSTVSSGYGGASGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRAIGGGLSSVGGGSSTIKYTTTSSSSRKSYKH

MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRISSAGASFGSRSLYNLGGAKRVSINGCGSSCRSGFGGRASNRFGVNSGFGYGGGVGGGFSGPSFPVCPPGGIQEVTVNQSLLTPLHLQIDPTIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWALLQEQGSRTVRQNLEPLFDSYTSELRRQLESITTERGRLEAELRNMQDVVEDFKVRYEDEINKRTAAENEFVALKKDVDAAYMNKVELEAKVKSLPEEINFIHSVFDAELSQLQTQVGDTSVVLSMDNNRNLDLDSIIAEVKAQYEDIANRSRAEAESWYQTKYEELQVTAGRHGDDLRNTKQEISEMNRMIQRLRAEIDSVKKQCSSLQTAIADAEQRGELALKDARAKLVDLEEALQKAKQDMARLLREYQELMNIKLALDVEIATYRKLLEGEECRLSGEGVSPVNISVVTSTLSSGYGSGSSIGGGNLGLGGGSGYSFTTSGGHSLGAGLGGSGFSATSNRGLGGSGSSVKFVSTTSSSQKSYTH

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
100
Dog
100
Pig
0
Bovine
0
Sheep
0
Xenopus
0
Zebrafish
0
Chicken
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q01546/P12035/P02538/O95678 As Substrate

Site PTM Type Enzyme
S3 Phosphorylation
S5 Phosphorylation
S10 Phosphorylation
S19 Phosphorylation
S22 Phosphorylation
S31 Phosphorylation
S34 Phosphorylation
S37 Phosphorylation
S41 Phosphorylation
R42 Methylation
S44 Phosphorylation
S58 Phosphorylation
S60 Phosphorylation
Y62 Phosphorylation
S67 Phosphorylation
S71 Phosphorylation
S76 Phosphorylation
S80 Phosphorylation
Y83 Phosphorylation
S85 Phosphorylation
K168 Ubiquitination
T169 Phosphorylation
K173 Acetylation
K173 Methylation
K173 Sumoylation
K173 Ubiquitination
S176 Phosphorylation
K180 Acetylation
K180 Ubiquitination
K194 Ubiquitination
K204 Ubiquitination
Y217 Phosphorylation
S237 Phosphorylation
K252 Methylation
K252 Ubiquitination
Y253 Phosphorylation
K259 Methylation
K259 Ubiquitination
Y278 Phosphorylation
T290 Phosphorylation
Y302 Phosphorylation
S332 Phosphorylation
Y341 Phosphorylation
S348 Phosphorylation
Y356 Phosphorylation
T358 Phosphorylation
Y360 Phosphorylation
T366 Phosphorylation
S393 Phosphorylation
K426 Acetylation
Y448 Phosphorylation
R475 Methylation
S540 Phosphorylation
S541 Phosphorylation
S546 Phosphorylation
K550 Methylation
Y551 Phosphorylation
T552 Phosphorylation
S557 Phosphorylation
S558 Phosphorylation
S561 Phosphorylation
Site PTM Type Enzyme
S13 Phosphorylation
S17 Phosphorylation
S20 Phosphorylation
S56 Phosphorylation
S65 Phosphorylation
K203 Ubiquitination
T204 Phosphorylation
K208 Acetylation
K208 Methylation
K208 Sumoylation
K208 Ubiquitination
S211 Phosphorylation
K215 Acetylation
K215 Ubiquitination
S274 Phosphorylation
K289 Ubiquitination
S364 Phosphorylation
Y393 Phosphorylation
T395 Phosphorylation
T402 Phosphorylation
Y511 Phosphorylation
Y597 Phosphorylation
S605 Phosphorylation
S606 Phosphorylation
S608 Phosphorylation
S613 Phosphorylation
Site PTM Type Enzyme
S14 Phosphorylation
S18 Phosphorylation
S21 Phosphorylation
Y59 Phosphorylation
S76 Phosphorylation
K188 Ubiquitination
T189 Phosphorylation
K193 Acetylation
K193 Methylation
K193 Sumoylation
K193 Ubiquitination
S196 Phosphorylation
K200 Acetylation
K200 Ubiquitination
K272 Ubiquitination
Y361 Phosphorylation
Y376 Phosphorylation
T385 Phosphorylation
T427 Phosphorylation
R495 Methylation
S541 Phosphorylation
S542 Phosphorylation
S544 Phosphorylation
Y549 Phosphorylation
S620 Phosphorylation
S626 Phosphorylation
Site PTM Type Enzyme
S6 Phosphorylation
T8 Phosphorylation
S11 Phosphorylation
S18 Phosphorylation
S34 Phosphorylation
S36 Phosphorylation
S40 Phosphorylation
S44 Phosphorylation
S56 Phosphorylation
S59 Phosphorylation
S61 Phosphorylation
K69 Acetylation
S72 Phosphorylation
K154 Ubiquitination
T155 Phosphorylation
K159 Acetylation
K159 Methylation
K159 Sumoylation
K159 Ubiquitination
S162 Phosphorylation
K166 Acetylation
K166 Ubiquitination
T191 Phosphorylation
Y264 Phosphorylation
T297 Phosphorylation
T302 Phosphorylation
S318 Phosphorylation
K324 Ubiquitination
Y327 Phosphorylation
S334 Phosphorylation
Y342 Phosphorylation
T344 Phosphorylation
Y346 Phosphorylation
T352 Phosphorylation
S383 Phosphorylation
K407 Ubiquitination
K424 Sumoylation
Y434 Phosphorylation
R461 Methylation
S532 Phosphorylation
S545 Phosphorylation

Research Backgrounds

Function:

Probably contributes to terminal cornification.

Subunit Structure:

Heterotetramer of two type I and two type II keratins.

Family&Domains:

Belongs to the intermediate filament family.

Tissue Specificity:

Cornea specific.

Subunit Structure:

Heterotetramer of two type I and two type II keratins. Keratin-3 associates with keratin-12.

Family&Domains:

Belongs to the intermediate filament family.

Function:

Epidermis-specific type I keratin involved in wound healing. Involved in the activation of follicular keratinocytes after wounding, while it does not play a major role in keratinocyte proliferation or migration. Participates in the regulation of epithelial migration by inhibiting the activity of SRC during wound repair.

Tissue Specificity:

Constitutively expressed in distinct types of epithelia such as those in oral mucosa, esophagus, papillae of tongue and hair follicle outer root sheath.

Subunit Structure:

Heterodimer of a type I and a type II keratin. KRT6 isomers associate with KRT16 and/or KRT17 (By similarity). Interacts with TCHP.

Family&Domains:

Belongs to the intermediate filament family.

Function:

Plays a central role in hair and nail formation. Essential component of keratin intermediate filaments in the companion layer of the hair follicle.

Tissue Specificity:

Highly expressed in hair follicles from scalp. Specifically expressed in the of the hair companion layer follicle, a single layered band of flat and vertically oriented cells between the cuboidal outer root sheath (ORS) cells and the inner root sheath (IRS) that stretches from the lowermost bulb region to the isthmus of the follicle. Also expressed in medullated hairs. In nails, it is almost exclusively present in the nail bed (at protein level).

Subunit Structure:

Heterodimer of a type I and a type II keratin. May associate with KRT17.

Family&Domains:

Belongs to the intermediate filament family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.