INSL5 Antibody - #DF8991
Product: | INSL5 Antibody |
Catalog: | DF8991 |
Description: | Rabbit polyclonal antibody to INSL5 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Sheep, Rabbit |
Mol.Wt.: | 15 kDa; 15kD(Calculated). |
Uniprot: | Q9Y5Q6 |
RRID: | AB_2842187 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8991, RRID:AB_2842187.
Fold/Unfold
INSL5; INSL5_HUMAN; Insulin like peptide INSL5; Insulin-like peptide 5; Insulin-like peptide INSL5 A chain; MGC126695; MGC126697; PRO182; RIF2; RP24-72J16.1; UNQ156; UNQ156/PRO182;
Immunogens
Highly expressed in rectum with lower levels in uterus and ascending and descending colon.
- Q9Y5Q6 INSL5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKGSIFTLFLFSVLFAISEVRSKESVRLCGLEYIRTVIYICASSRWRRHQEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSRQDLQTLCCTDGCSMTDLSALC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
May have a role in gut contractility or in thymic development and regulation. Activates RXFP4 with high potency and appears to be the endogenous ligand for this receptor.
Secreted.
Highly expressed in rectum with lower levels in uterus and ascending and descending colon.
Heterodimer of a B chain and an A chain linked by two disulfide bonds.
Belongs to the insulin family.
Research Fields
· Organismal Systems > Endocrine system > Relaxin signaling pathway.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.