IL17F Antibody - #DF8981
Product: | IL17F Antibody |
Catalog: | DF8981 |
Description: | Rabbit polyclonal antibody to IL17F |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Prediction: | Horse |
Mol.Wt.: | 18 kDa; 18kD(Calculated). |
Uniprot: | Q96PD4 |
RRID: | AB_2842177 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8981, RRID:AB_2842177.
Fold/Unfold
CANDF6; Cytokine ML 1; Cytokine ML-1; IL 17F; IL 24; IL-17F; Il17f; IL17F_HUMAN; Interleukin 17F; Interleukin 24; Interleukin-17F; ML 1; ML1; Mutant IL 17F; OTTHUMP00000016602;
Immunogens
- Q96PD4 IL17F_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96PD4 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
N83 | N-Glycosylation | Uniprot | |
S117 | Phosphorylation | Uniprot |
Research Backgrounds
Ligand for IL17RA and IL17RC. The heterodimer formed by IL17A and IL17F is a ligand for the heterodimeric complex formed by IL17RA and IL17RC. Involved in stimulating the production of other cytokines such as IL6, IL8 and CSF2, and in regulation of cartilage matrix turnover. Also involved in stimulating the proliferation of peripheral blood mononuclear cells and T-cells and in inhibition of angiogenesis. Plays a role in the induction of neutrophilia in the lungs and in the exacerbation of antigen-induced pulmonary allergic inflammation (By similarity).
Secreted.
Expressed in activated, but not resting, CD4+ T-cells and activated monocytes.
Homodimer; disulfide-linked. Heterodimer with IL17A.
Belongs to the IL-17 family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Human Diseases > Immune diseases > Inflammatory bowel disease (IBD).
· Organismal Systems > Immune system > IL-17 signaling pathway. (View pathway)
· Organismal Systems > Immune system > Th17 cell differentiation. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.