IFNK Antibody - #DF8974
Product: | IFNK Antibody |
Catalog: | DF8974 |
Description: | Rabbit polyclonal antibody to IFNK |
Application: | WB |
Reactivity: | Human |
Mol.Wt.: | 25 kDa; 25kD(Calculated). |
Uniprot: | Q9P0W0 |
RRID: | AB_2842170 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8974, RRID:AB_2842170.
Fold/Unfold
IFN kappa; IFN-kappa; Ifnk; IFNK_HUMAN; Interferon kappa;
Immunogens
- Q9P0W0 IFNK_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSTKPDMIQKCLWLEILMGIFIAGTLSLDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK
PTMs - Q9P0W0 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S158 | Phosphorylation | Uniprot |
Research Backgrounds
May play a role in the regulation of immune cell function. Cytokine that imparts cellular protection against viral infection in a species-specific manner. Activates the interferon-stimulated response element signaling pathway. It is able to directly modulate cytokine release from monocytes and dendritic cells. Binds heparin.
Secreted.
Expressed in keratinocytes, monocytes and in resting dendritic cells.
Belongs to the alpha/beta interferon family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway. (View pathway)
· Organismal Systems > Immune system > RIG-I-like receptor signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.