ICBR Antibody - #DF8960
| Product: | ICBR Antibody |
| Catalog: | DF8960 |
| Description: | Rabbit polyclonal antibody to ICBR |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 10 kDa; 10kD(Calculated). |
| Uniprot: | P57730 |
| RRID: | AB_2842156 |
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8960, RRID:AB_2842156.
Fold/Unfold
CAR18_HUMAN; CARD18; Caspase 1 inhibitor Iceberg; Caspase recruitment domain family member 18; Caspase recruitment domain-containing protein 18; Caspase-1 inhibitor Iceberg; ICEBERG caspase 1 inhibitor; Pseudo ICE; UNQ5804; UNQ5804/PRO19611;
Immunogens
A synthesized peptide derived from human ICBR, corresponding to a region within C-terminal amino acids.
- P57730 CAR18_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDPQLASKMGLH
Research Backgrounds
Inhibits generation of IL-1-beta by interacting with caspase-1 and preventing its association with RIP2. Down-regulates the release of IL1B.
Primarily expressed in the heart and placenta.
Research Fields
· Organismal Systems > Immune system > NOD-like receptor signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.