DRD1IP Antibody - #DF8939
| Product: | DRD1IP Antibody |
| Catalog: | DF8939 |
| Description: | Rabbit polyclonal antibody to DRD1IP |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Rabbit, Dog |
| Mol.Wt.: | 23 kDa; 23kD(Calculated). |
| Uniprot: | Q9NYX4 |
| RRID: | AB_2842135 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8939, RRID:AB_2842135.
Fold/Unfold
CALCYON; Caly; CALY_HUMAN; D1 dopamine receptor interacting protein; Drd1ip; Neuron specific vesicular protein calcyon; Neuron-specific vesicular protein calcyon; NSG3; RP11-122K13.5;
Immunogens
Expressed in the pyramidal cells of the prefrontal cortex, in hippothalamus and in caudate nucleus. No expression in spleen. Up-regulated in the prefrontal cortex of schizophrenic patients with nearly twice the levels of non-schizophrenics.
- Q9NYX4 CALY_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPDQQNFPDLEGQRLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLRHKICTPLTLEMYYTEMDPERHRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPTQAGAAAAATEPPGKPSAKAEKEAARKAAGSAAPPPAQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NYX4 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|
Research Backgrounds
Interacts with clathrin light chain A and stimulates clathrin self-assembly and clathrin-mediated endocytosis.
Glycosylated.
Cytoplasmic vesicle membrane>Single-pass membrane protein. Cell membrane>Single-pass membrane protein.
Expressed in the pyramidal cells of the prefrontal cortex, in hippothalamus and in caudate nucleus. No expression in spleen. Up-regulated in the prefrontal cortex of schizophrenic patients with nearly twice the levels of non-schizophrenics.
Interacts with CLTA.
Belongs to the NSG family.
Research Fields
· Organismal Systems > Nervous system > Dopaminergic synapse.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.