CCRN4L Antibody - #DF8828
| Product: | CCRN4L Antibody |
| Catalog: | DF8828 |
| Description: | Rabbit polyclonal antibody to CCRN4L |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat, Monkey |
| Prediction: | Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 48 kDa; 48kD(Calculated). |
| Uniprot: | Q9UK39 |
| RRID: | AB_2842025 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8828, RRID:AB_2842025.
Fold/Unfold
CCR4 carbon catabolite repression 4 like (S. cerevisiae); CCR4 protein homolog; CCRN4L; NOC;
Immunogens
Adipose tissue. Expression is higher in subcutaneous adipose tissue as compared to visceral adipose tissue.
- Q9UK39 NOCT_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MFHSPRRLCSALLQRDAPGLRRLPAPGLRRPLSPPAAVPRPASPRLLAAASAASGAARSCSRTVCSMGTGTSRLYSALAKTLNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVDLRTDCPSTHPPIRVMQWNILAQALGEGKDNFVQCPVEALKWEERKCLILEEILAYQPDILCLQEVDHYFDTFQPLLSRLGYQGTFFPKPWSPCLDVEHNNGPDGCALFFLQNRFKLVNSANIRLTAMTLKTNQVAIAQTLECKESGRQFCIAVTHLKARTGWERFRSAQGCDLLQNLQNITQGAKIPLIVCGDFNAEPTEEVYKHFASSSLNLNSAYKLLSADGQSEPPYTTWKIRTSGECRHTLDYIWYSKHALNVRSALDLLTEEQIGPNRLPSFNYPSDHLSLVCDFSFTEESDGLS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9UK39 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S33 | Phosphorylation | Uniprot | |
| S43 | Phosphorylation | Uniprot | |
| S66 | Phosphorylation | Uniprot | |
| T69 | Phosphorylation | Uniprot | |
| T71 | Phosphorylation | Uniprot | |
| S72 | Phosphorylation | Uniprot | |
| S96 | Phosphorylation | Uniprot | |
| R121 | Methylation | Uniprot | |
| R124 | Methylation | Uniprot | |
| K171 | Ubiquitination | Uniprot | |
| K274 | Ubiquitination | Uniprot | |
| T285 | Phosphorylation | Uniprot | |
| K365 | Ubiquitination | Uniprot |
Research Backgrounds
Phosphatase which catalyzes the conversion of NADP(+) to NAD(+) and of NADPH to NADH. Shows a small preference for NADPH over NADP(+). Represses translation and promotes degradation of target mRNA molecules. Plays an important role in post-transcriptional regulation of metabolic genes under circadian control (By similarity). Exerts a rhythmic post-transcriptional control of genes necessary for metabolic functions including nutrient absorption, glucose/insulin sensitivity, lipid metabolism, adipogenesis, inflammation and osteogenesis (By similarity). Plays an important role in favoring adipogenesis over osteoblastogenesis and acts as a key regulator of the adipogenesis/osteogenesis balance (By similarity). Promotes adipogenesis by facilitating PPARG nuclear translocation which activates its transcriptional activity (By similarity). Regulates circadian expression of NOS2 in the liver and negatively regulates the circadian expression of IGF1 in the bone (By similarity). Critical for proper development of early embryos (By similarity).
Cytoplasm. Nucleus. Cytoplasm>Perinuclear region. Mitochondrion.
Adipose tissue. Expression is higher in subcutaneous adipose tissue as compared to visceral adipose tissue.
Interacts with PPARG.
Belongs to the CCR4/nocturin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.