TAF10 Antibody - #DF8819
Product: | TAF10 Antibody |
Catalog: | DF8819 |
Description: | Rabbit polyclonal antibody to TAF10 |
Application: | WB |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Rabbit, Dog |
Mol.Wt.: | 22 kDa; 22kD(Calculated). |
Uniprot: | Q12962 |
RRID: | AB_2842016 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8819, RRID:AB_2842016.
Fold/Unfold
dTAF(II)24; TAF24; TAF2H; TAFII24; TAFII30; Transcription initiation factor TFIID 24 kDa subunit; Transcription initiation factor TFIID subunit 10;
Immunogens
A synthesized peptide derived from human TAF10, corresponding to a region within N-terminal amino acids.
- Q12962 TAF10_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGGTGPLAARAGEPAERRGAAPVSAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
TAFs are components of the transcription factor IID (TFIID) complex, PCAF histone acetylase complex and TBP-free TAFII complex (TFTC). TIIFD is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors.
Monomethylated at Lys-189 by SETD7, leading to increased affinity for RNA polymerase II.
Lysine deamination at Lys-189 to form allysine is mediated by LOXL2. Allysine formation by LOXL2 results in release of TAF10 from promoters, leading to inhibition of TFIID-dependent transcription.
Nucleus.
The [KR]-[STA]-K motif is specifically recognized by the SETD7 methyltransferase.
Belongs to the TAF10 family.
Research Fields
· Genetic Information Processing > Transcription > Basal transcription factors.
· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.