MRP Antibody - #DF8801
(2)
(6)
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8801, RRID:AB_2841999.
Fold/Unfold
F52; Mac MARCKS; Mac-MARCKS; MacMARCKS; Macrophage enriched Myristoylated Alanine Rich C Kinase Substrate Like Protein; Macrophage myristoylated alanine-rich C kinase substrate; MARCKS like 1; MARCKS like protein 1; MARCKS related protein; MARCKS-like protein 1; MARCKS-related protein; MARCKSL1; MLP; MLP1; MRP; MRP_HUMAN;
Immunogens
- P49006 MRP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPPSQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P49006 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| G2 | Myristoylation | Uniprot | |
| T14 | Phosphorylation | Uniprot | |
| S22 | Phosphorylation | Uniprot | |
| K25 | Ubiquitination | Uniprot | |
| K35 | Ubiquitination | Uniprot | |
| S36 | Phosphorylation | Uniprot | |
| S41 | Phosphorylation | Uniprot | |
| K43 | Ubiquitination | Uniprot | |
| S48 | Phosphorylation | Uniprot | |
| T54 | Phosphorylation | Uniprot | |
| S71 | Phosphorylation | Q13535 (ATR) | Uniprot |
| K83 | Ubiquitination | Uniprot | |
| T85 | Phosphorylation | Uniprot | |
| K88 | Ubiquitination | Uniprot | |
| S93 | Phosphorylation | Uniprot | |
| K95 | Ubiquitination | Uniprot | |
| K99 | Ubiquitination | Uniprot | |
| S101 | Phosphorylation | Uniprot | |
| S104 | Phosphorylation | Uniprot | |
| K106 | Acetylation | Uniprot | |
| K106 | Ubiquitination | Uniprot | |
| K110 | Ubiquitination | Uniprot | |
| S116 | Phosphorylation | Uniprot | |
| S117 | Phosphorylation | Uniprot | |
| S119 | Phosphorylation | Uniprot | |
| S120 | Phosphorylation | Uniprot | |
| T122 | Phosphorylation | Uniprot | |
| C134 | S-Nitrosylation | Uniprot | |
| S135 | Phosphorylation | Uniprot | |
| K144 | Ubiquitination | Uniprot | |
| T148 | Phosphorylation | Uniprot | |
| S151 | Phosphorylation | Uniprot | |
| S162 | Phosphorylation | Uniprot | |
| S165 | Phosphorylation | Uniprot | |
| T174 | Phosphorylation | Uniprot | |
| S177 | Phosphorylation | Uniprot | |
| T178 | Phosphorylation | Uniprot | |
| S180 | Phosphorylation | Uniprot | |
| S184 | Phosphorylation | Uniprot |
Research Backgrounds
Controls cell movement by regulating actin cytoskeleton homeostasis and filopodium and lamellipodium formation. When unphosphorylated, induces cell migration (By similarity). When phosphorylated by MAPK8, induces actin bundles formation and stabilization, thereby reducing actin plasticity, hence restricting cell movement, including neuronal migration (By similarity). May be involved in coupling the protein kinase C and calmodulin signal transduction systems (By similarity).
Phosphorylated. Phosphorylation at Ser-120 and Thr-178 is non-redundantly catalyzed by MAPK8 in vivo. Phosphorylation at Thr-148 is preferentially catalyzed by MAPK8 in vivo, but this modification can also be catalyzed by other kinases in the absence of MAPK8. May be phosphorylated by protein kinase C, which disrupts the interaction with calmodulin.
Cytoplasm>Cytoskeleton. Cell membrane>Lipid-anchor.
Note: Associates with the membrane via the insertion of the N-terminal N-myristoyl chain and the partial insertion of the effector domain. Association of the effector domain with membranes may be regulated by Ca(2+)/calmodulin. Colocalizes with F-actin at the leading edge of migrating cells (By similarity). In prostate cancers, shows strong expression at apical and/or basal regions of the cell and also has weak cytoplasmic expression (PubMed:22751924).
Binds to filamentous actin (F-actin), but not to monomeric G-actin, independently of its phosphorylation status.
Belongs to the MARCKS family.
Research Fields
· Human Diseases > Infectious diseases: Parasitic > Leishmaniasis.
· Organismal Systems > Immune system > Fc gamma R-mediated phagocytosis. (View pathway)
References
Application: WB Species: Human Sample: PANC-1 and PANC-1/GEM cells
Application: WB Species: Mice Sample: tumor tissues
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.