Adrenergic Receptor alpha -1B Antibody - #DF8798
(1)
(2)
| Product: | Adrenergic Receptor alpha -1B Antibody |
| Catalog: | DF8798 |
| Description: | Rabbit polyclonal antibody to Adrenergic Receptor alpha -1B |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat, Monkey |
| Prediction: | Rabbit, Dog, Chicken |
| Mol.Wt.: | 56 kDa; 57kD(Calculated). |
| Uniprot: | P35368 |
| RRID: | AB_2841996 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8798, RRID:AB_2841996.
Fold/Unfold
ADA1B_HUMAN; ADRA 1; Adra 1b; ADRA1; ADRA1B; Adrenergic alpha 1B receptor; Adrenergic receptor alpha 1b; Adrenoceptor alpha 1B; Alpha 1 adrenergic receptor; Alpha 1B adrenoceptor; Alpha 1B adrenoreceptor; Alpha-1B adrenergic receptor; Alpha-1B adrenoceptor; Alpha-1B adrenoreceptor; Alpha1 adrenergic receptor; Alpha1B adrenergic receptor; Alpha1BAR;
Immunogens
- P35368 ADA1B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAIVGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFVRILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRTLPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLTEPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P35368 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y144 | Phosphorylation | Uniprot | |
| Y149 | Phosphorylation | Uniprot | |
| Y153 | Phosphorylation | Uniprot | |
| R389 | Methylation | Uniprot | |
| R393 | Methylation | Uniprot | |
| S396 | Phosphorylation | P17252 (PRKCA) | Uniprot |
| R399 | Methylation | Uniprot | |
| S402 | Phosphorylation | P17252 (PRKCA) | Uniprot |
| R403 | Methylation | Uniprot | |
| S406 | Phosphorylation | P17252 (PRKCA) | Uniprot |
| S410 | Phosphorylation | P17252 (PRKCA) | Uniprot |
| S412 | Phosphorylation | P17252 (PRKCA) | Uniprot |
| S417 | Phosphorylation | Uniprot | |
| S470 | Phosphorylation | Uniprot |
Research Backgrounds
This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regulate phenylephrine (PE)-stimulated ERK signaling in cardiac myocytes.
Nucleus membrane>Multi-pass membrane protein. Cell membrane>Multi-pass membrane protein. Cytoplasm. Membrane>Caveola.
Note: Location at the nuclear membrane facilitates heterooligomerization and regulates ERK-mediated signaling in cardiac myocytes. signaling in cardiac myocytes. Colocalizes with GNAQ, PLCB1 as well as LAP2 at the nuclear membrane of cardiac myocytes.
Homo- and heterooligomer. Heterooligomerizes with ADRA1B homooligomers in cardiac myocytes. Interacts with CAVIN4.
Belongs to the G-protein coupled receptor 1 family. Adrenergic receptor subfamily. ADRA1B sub-subfamily.
Research Fields
· Environmental Information Processing > Signal transduction > Calcium signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > cGMP-PKG signaling pathway. (View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
· Organismal Systems > Circulatory system > Adrenergic signaling in cardiomyocytes. (View pathway)
· Organismal Systems > Circulatory system > Vascular smooth muscle contraction. (View pathway)
· Organismal Systems > Digestive system > Salivary secretion.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.