SAP30 Antibody - #DF8763
| Product: | SAP30 Antibody |
| Catalog: | DF8763 |
| Description: | Rabbit polyclonal antibody to SAP30 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 23 kDa; 23kD(Calculated). |
| Uniprot: | O75446 |
| RRID: | AB_2841967 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8763, RRID:AB_2841967.
Fold/Unfold
30 kDa Sin3-associated polypeptide; Histone deacetylase complex subunit SAP 30; Histone deacetylase complex subunit SAP30; MSin3A associated polypeptide p30; SAP 30; Sap30; SAP30_HUMAN; Sin3 associated polypeptide 30 kDa; Sin3 associated polypeptide 30kD; Sin3 associated polypeptide; Sin3 corepressor complex subunit SAP 30; Sin3 corepressor complex subunit SAP30; Sin3-associated polypeptide p30; Sin3A associated protein 30kDa; Sin3A associated protein;
Immunogens
Expressed in all tissues tested with highest levels in pancreas, ovary, PBL, spleen and thymus; lowest levels in brain, placenta, lung and kidney.
- O75446 SAP30_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNGFTPDEMSRGGDAAAAVAAVVAAAAAAASAGNGTGAGTGAEVPGAGAVSAAGPPGAAGPGPGQLCCLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQSVRNRRKRKGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTLTYFIYSVKNDKNKSDLKVDSGVH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O75446 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T5 | Phosphorylation | Uniprot | |
| K87 | Sumoylation | Uniprot | |
| K87 | Ubiquitination | Uniprot | |
| K91 | Ubiquitination | Uniprot | |
| K104 | Acetylation | Uniprot | |
| K104 | Ubiquitination | Uniprot | |
| S131 | Phosphorylation | Uniprot | |
| S138 | Phosphorylation | Uniprot | |
| T145 | Phosphorylation | Uniprot | |
| Y151 | Phosphorylation | Uniprot | |
| K166 | Acetylation | Uniprot | |
| T169 | Phosphorylation | Uniprot | |
| K175 | Acetylation | Uniprot | |
| K175 | Ubiquitination | Uniprot | |
| K194 | Ubiquitination | Uniprot | |
| T196 | Phosphorylation | Uniprot | |
| Y199 | Phosphorylation | Uniprot | |
| Y202 | Phosphorylation | Uniprot | |
| K205 | Sumoylation | Uniprot | |
| K214 | Sumoylation | Uniprot | |
| K214 | Ubiquitination | Uniprot |
Research Backgrounds
Involved in the functional recruitment of the Sin3-histone deacetylase complex (HDAC) to a specific subset of N-CoR corepressor complexes. Capable of transcription repression by N-CoR. Active in deacetylating core histone octamers (when in a complex) but inactive in deacetylating nucleosomal histones.
Nucleus.
Expressed in all tissues tested with highest levels in pancreas, ovary, PBL, spleen and thymus; lowest levels in brain, placenta, lung and kidney.
Interacts with SIN3A, SIN3B, HDAC2 and NCOR1. Interacts with SAMS1. Component of the histone deacetylase complex that includes at least SIN3A, HDAC1 and HDAC2 (By similarity). Interacts with HDAC1. Interacts with HCFC1. Found in a complex composed of at least SINHCAF, SIN3A, HDAC1, SAP30, RBBP4, OGT and TET1 (By similarity).
Belongs to the SAP30 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.