LSM1 Antibody - #DF8754
| Product: | LSM1 Antibody |
| Catalog: | DF8754 |
| Description: | Rabbit polyclonal antibody to LSM1 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 15~25 kDa; 15kD(Calculated). |
| Uniprot: | O15116 |
| RRID: | AB_2841958 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8754, RRID:AB_2841958.
Fold/Unfold
Cancer associated Sm like protein; Cancer associated Sm-like; Cancer-associated Sm-like; CASM; lsm1; LSM1 antibody; LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae); Lsm1 protein; LSM1, U6 small nuclear RNA associated; LSM1_HUMAN; Small nuclear ribonuclear CaSm; U6 snRNA associated Sm-like protein LSm1; U6 snRNA-associated Sm-like protein LSm1; YJL124C;
Immunogens
- O15116 LSM1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O15116 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S123 | Phosphorylation | Uniprot | |
| T129 | Phosphorylation | Uniprot | |
| Y133 | Phosphorylation | Uniprot |
Research Backgrounds
Plays a role in the degradation of histone mRNAs, the only eukaryotic mRNAs that are not polyadenylated. Probably also part of an LSm subunits-containing complex involved in the general process of mRNA degradation (By similarity).
Cytoplasm. Cytoplasm>P-body.
Interacts with SLBP; interaction with SLBP occurs when histone mRNA is being rapidly degraded during the S phase. LSm subunits form a heteromer with a donut shape (By similarity).
Belongs to the snRNP Sm proteins family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > RNA degradation.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.