Phospho-Casein Kinase 1 alpha (Tyr294) Antibody - #DF8736

(3)  
Product: Phospho-Casein Kinase 1 alpha (Tyr294) Antibody
Catalog: DF8736
Description: Rabbit polyclonal antibody to Phospho-Casein Kinase 1 alpha (Tyr294)
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 38 kDa; 39kD(Calculated).
Uniprot: P48729 | Q8N752
RRID: AB_2841940

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Zebrafish(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
Phospho-Casein Kinase 1 alpha (Tyr294) Antibody detects endogenous levels of Casein Kinase 1 alpha only when phosphorylated at PhoTyr294.
RRID:
AB_2841940
Cite Format: Affinity Biosciences Cat# DF8736, RRID:AB_2841940.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Casein kinase 1 alpha 1; Casein kinase I isoform alpha; CK1; CK1A; CKI alpha; CKI-alpha; CKIa; Clock regulator kinase; Csnk1a1; Down regulated in lung cancer; HLCDGP1; KC1A_HUMAN; PRO2975; Casein kinase 1, alpha 1 like; casein kinase 1, alpha 1-like; Casein kinase I alpha S like; Casein kinase I isoform alpha like; CK1; CKI alpha like; MGC33182; OTTHUMP00000018267; RP11 532O21.2;

Immunogens

Immunogen:
Uniprot:

P48729(KC1A_HUMAN) >>Visit HPA database.

Q8N752(KC1AL_HUMAN) >>Visit HPA database.

Gene(ID):
CSNK1A1L(122011) | CSNK1A1(1452)
Sequence:
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF

MTNNSGSKAELVVGGKYKLVRKIGSGSFGDVYLGITTTNGEDVAVKLESQKVKHPQLLYESKLYTILQGGVGIPHMHWYGQEKDNNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFLHRDIKPDNFLMGTGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKHLIGTVRYASINAHLGIEQSRRDDMESLGYVFMYFNRTSLPWQGLRAMTKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEVPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKDN

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Zebrafish
100
Chicken
100
Rabbit
100
Pig
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P48729/Q8N752 As Substrate

Site PTM Type Enzyme
A2 Acetylation
S3 Phosphorylation
S4 Phosphorylation
K8 Acetylation
K8 Ubiquitination
K16 Acetylation
K16 Ubiquitination
Y17 Phosphorylation
Y32 Phosphorylation
K51 Ubiquitination
Y59 Phosphorylation
K62 Ubiquitination
K65 Ubiquitination
Y85 Phosphorylation
S105 Phosphorylation
K138 Ubiquitination
K152 Ubiquitination
K162 Ubiquitination
K179 Ubiquitination
T184 Phosphorylation
S199 Phosphorylation
S218 Phosphorylation P17612 (PRKACA)
K225 Ubiquitination
K229 Ubiquitination
K240 Ubiquitination
S242 Phosphorylation P17612 (PRKACA)
Y274 Phosphorylation
T287 Phosphorylation
Y292 Phosphorylation
Y294 Phosphorylation
K302 Ubiquitination
K304 Ubiquitination
S311 Phosphorylation
S313 Phosphorylation
T321 Phosphorylation
T323 Phosphorylation
K325 Ubiquitination
T327 Phosphorylation
S332 Phosphorylation
K335 Ubiquitination
Site PTM Type Enzyme
K53 Acetylation
Y59 Phosphorylation
K62 Acetylation
K83 Acetylation
K130 Ubiquitination
T146 Phosphorylation
K152 Ubiquitination
K162 Ubiquitination
T184 Phosphorylation
S206 Phosphorylation
Y209 Phosphorylation
Y213 Phosphorylation
K240 Ubiquitination
T287 Phosphorylation
Y292 Phosphorylation
Y294 Phosphorylation
K302 Ubiquitination

PTMs - P48729/Q8N752 As Enzyme

Substrate Site Source
O15151 (MDM4) S289 Uniprot
O43524 (FOXO3) S318 Uniprot
O43524 (FOXO3) S321 Uniprot
O60260 (PRKN) S101 Uniprot
O60260 (PRKN) S378 Uniprot
O60346 (PHLPP1) S1359 Uniprot
O60346 (PHLPP1) T1363 Uniprot
O60346 (PHLPP1) S1379 Uniprot
O60346 (PHLPP1) S1381 Uniprot
O75581 (LRP6) T1493 Uniprot
O94916 (NFAT5) S158 Uniprot
P01106 (MYC) S252 Uniprot
P02730 (SLC4A1) T42 Uniprot
P02730 (SLC4A1) S303 Uniprot
P04637-1 (TP53) S6 Uniprot
P04637-1 (TP53) S9 Uniprot
P04637 (TP53) T18 Uniprot
P04637 (TP53) S20 Uniprot
P07910-2 (HNRNPC) S240 Uniprot
P07910-1 (HNRNPC) S253 Uniprot
P07910 (HNRNPC) S260 Uniprot
P07910 (HNRNPC) S299 Uniprot
P11308 (ERG) S44 Uniprot
P11308 (ERG) S45 Uniprot
P11308 (ERG) S46 Uniprot
P12830 (CDH1) S844 Uniprot
P16220 (CREB1) S108 Uniprot
P16220 (CREB1) S111 Uniprot
P16220 (CREB1) S114 Uniprot
P16220 (CREB1) S156 Uniprot
P17181 (IFNAR1) S535 Uniprot
P17931 (LGALS3) S6 Uniprot
P17931 (LGALS3) S12 Uniprot
P18846 (ATF1) S36 Uniprot
P18846 (ATF1) S41 Uniprot
P18846 (ATF1) S47 Uniprot
P18846 (ATF1) S50 Uniprot
P18846 (ATF1) S51 Uniprot
P25054 (APC) S1504 Uniprot
P25054 (APC) S1505 Uniprot
P25054 (APC) S1507 Uniprot
P25054 (APC) S1510 Uniprot
P27348 (YWHAQ) S232 Uniprot
P30304 (CDC25A) S79 Uniprot
P30304 (CDC25A) S82 Uniprot
P35222 (CTNNB1) S45 Uniprot
P37840 (SNCA) S87 Uniprot
P37840 (SNCA) S129 Uniprot
P40337 (VHL) S72 Uniprot
P42892 (ECE1) S34 Uniprot
P42892 (ECE1) S36 Uniprot
P49810-1 (PSEN2) S7 Uniprot
P49810-1 (PSEN2) S9 Uniprot
P49810-3 (PSEN2) S19 Uniprot
P55316 (FOXG1) S19 Uniprot
P55957-1 (BID) T59 Uniprot
P55957 (BID) S64 Uniprot
P56537 (EIF6) S174 Uniprot
P56537 (EIF6) S175 Uniprot
P56817 (BACE1) S498 Uniprot
P62745 (RHOB) S185 Uniprot
P63104-1 (YWHAZ) T232 Uniprot
Q00535 (CDK5) S159 Uniprot
Q03060-12 (CREM) S36 Uniprot
Q03060-30 (CREM) S50 Uniprot
Q03060-32 (CREM) S66 Uniprot
Q03060-16 (CREM) S110 Uniprot
Q04206 (RELA) S316 Uniprot
Q05940-1 (SLC18A2) S511 Uniprot
Q12778 (FOXO1) S322 Uniprot
Q12778 (FOXO1) S325 Uniprot
Q12968-2 (NFATC3) T204 Uniprot
Q12968-1 (NFATC3) S207 Uniprot
Q12968-2 (NFATC3) T210 Uniprot
Q12968-1 (NFATC3) S211 Uniprot
Q12968-3 (NFATC3) S215 Uniprot
Q13144 (EIF2B5) S51 Uniprot
Q13144 (EIF2B5) S466 Uniprot
Q13144 (EIF2B5) S469 Uniprot
Q13148 (TARDBP) S2 Uniprot
Q13148 (TARDBP) Y4 Uniprot
Q13148 (TARDBP) T25 Uniprot
Q13148 (TARDBP) T88 Uniprot
Q13148 (TARDBP) S91 Uniprot
Q13148 (TARDBP) S92 Uniprot
Q13148 (TARDBP) T116 Uniprot
Q13148 (TARDBP) S183 Uniprot
Q13148 (TARDBP) S242 Uniprot
Q13148 (TARDBP) S254 Uniprot
Q13148 (TARDBP) S273 Uniprot
Q13148 (TARDBP) S292 Uniprot
Q13148 (TARDBP) S305 Uniprot
Q13148 (TARDBP) S342 Uniprot
Q13148 (TARDBP) S347 Uniprot
Q13148 (TARDBP) S350 Uniprot
Q13148 (TARDBP) S369 Uniprot
Q13148 (TARDBP) S375 Uniprot
Q13148 (TARDBP) S377 Uniprot
Q13148 (TARDBP) S379 Uniprot
Q13148 (TARDBP) S387 Uniprot
Q13148 (TARDBP) S389 Uniprot
Q13148 (TARDBP) S393 Uniprot
Q13148 (TARDBP) S395 Uniprot
Q13148 (TARDBP) S403 Uniprot
Q13148 (TARDBP) S404 Uniprot
Q13148 (TARDBP) S407 Uniprot
Q13148 (TARDBP) S409 Uniprot
Q13148 (TARDBP) S410 Uniprot
Q13158 (FADD) S194 Uniprot
Q6IE81 (JADE1) S18 Uniprot
Q6IE81 (JADE1) S20 Uniprot
Q8TB45 (DEPTOR) T149 Uniprot
Q8TB45 (DEPTOR) S263 Uniprot
Q8TB45 (DEPTOR) S286 Uniprot
Q8TB45 (DEPTOR) S287 Uniprot
Q8TB45 (DEPTOR) S291 Uniprot
Q9BXL7 (CARD11) S615 Uniprot
Q9H6E5 (TUT1) S6 Uniprot
Q9NRF8 (CTPS2) S568 Uniprot
Q9Y2W7 (KCNIP3) S63 Uniprot
Q9Y4G8 (RAPGEF2) S1244 Uniprot
Q9Y4G8 (RAPGEF2) S1248 Uniprot
Substrate Site Source
O94916 (NFAT5) S158 Uniprot
P35222 (CTNNB1) S45 Uniprot

Research Backgrounds

Function:

Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling. Phosphorylates CTNNB1 at 'Ser-45'. May phosphorylate PER1 and PER2. May play a role in segregating chromosomes during mitosis. May play a role in keratin cytoskeleton disassembly and thereby, it may regulate epithelial cell migration.

Subcellular Location:

Cytoplasm. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Chromosome>Centromere>Kinetochore. Nucleus speckle. Cytoplasm>Cytoskeleton>Cilium basal body.
Note: Localizes to the centrosome in interphase cells, and to kinetochore fibers during mitosis. Also recruited to the keratin cytoskeleton (PubMed:23902688).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Monomer. Interacts with the Axin complex. Interacts with TUT1, leading to TUT1 phosphorylation. Interacts with FAM83H; recruits CSNK1A1 to keratin filaments.

Family&Domains:

Belongs to the protein kinase superfamily. CK1 Ser/Thr protein kinase family. Casein kinase I subfamily.

Function:

Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling (By similarity).

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the protein kinase superfamily. CK1 Ser/Thr protein kinase family. Casein kinase I subfamily.

Research Fields

· Environmental Information Processing > Signal transduction > Wnt signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Hedgehog signaling pathway.   (View pathway)

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Human Diseases > Cancers: Specific types > Breast cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Gastric cancer.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.