TMPRSS3 Antibody - #DF8730
Product: | TMPRSS3 Antibody |
Catalog: | DF8730 |
Description: | Rabbit polyclonal antibody to TMPRSS3 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Horse, Sheep, Dog, Chicken |
Mol.Wt.: | 49 kDa; 49kD(Calculated). |
Uniprot: | P57727 |
RRID: | AB_2841934 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8730, RRID:AB_2841934.
Fold/Unfold
Deafness autosomal recessive 10; DFNB10; DFNB8; ECHOS1; Gene similar to transmembrane serine protease; MGC130589; Serine protease TADG-12; si:dz69g10.3; TADG12; TMPRSS 3; TMPRSS3; TMPS3_HUMAN; Transmembrane protease serine 3; Tumor associated differentially expressed gene 12 protein; Tumor-associated differentially-expressed gene 12 protein; UNQ323/PRO382;
Immunogens
Expressed in many tissues including fetal cochlea. Isoform T is found at increased levels in some carcinomas.
- P57727 TMPS3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFPIIVIGIIALILALAIGLGIHFDCSGKYRCRSSFKCIELIARCDGVSDCKDGEDEYRCVRVGGQNAVLQVFTAASWKTMCSDDWKGHYANVACAQLGFPSYVSSDNLRVSSLEGQFREEFVSIDHLLPDDKVTALHHSVYVREGCASGHVVTLQCTACGHRRGYSSRIVGGNMSLLSQWPWQASLQFQGYHLCGGSVITPLWIITAAHCVYDLYLPKSWTIQVGLVSLLDNPAPSHLVEKIVYHSKYKPKRLGNDIALMKLAGPLTFNEMIQPVCLPNSEENFPDGKVCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLTGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWIHEQMERDLKT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P57727 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K99 | Ubiquitination | Uniprot | |
K295 | Ubiquitination | Uniprot |
Research Backgrounds
Probable serine protease that plays a role in hearing. Acts as a permissive factor for cochlear hair cell survival and activation at the onset of hearing and is required for saccular hair cell survival (By similarity). Activates ENaC (in vitro).
Undergoes autoproteolytic activation.
Endoplasmic reticulum membrane>Single-pass type II membrane protein.
Expressed in many tissues including fetal cochlea. Isoform T is found at increased levels in some carcinomas.
Belongs to the peptidase S1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.