TAS2R43 Antibody - #DF8726
| Product: | TAS2R43 Antibody |
| Catalog: | DF8726 |
| Description: | Rabbit polyclonal antibody to TAS2R43 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 35 kDa; 36kD(Calculated). |
| Uniprot: | P59537 |
| RRID: | AB_2841930 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8726, RRID:AB_2841930.
Fold/Unfold
T2R43; T2R43_HUMAN; T2R52; TAS2R43; Taste receptor type 2 member 43; Taste receptor type 2 member 52;
Immunogens
A synthesized peptide derived from human TAS2R43, corresponding to a region within the internal amino acids.
Expressed in subsets of taste receptor cells of the tongue and exclusively in gustducin-positive cells. Expressed in airway epithelia.
- P59537 T2R43_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MITFLPIIFSSLVVVTFVIGNFANGFIALVNSIEWFKRQKISFADQILTALAVSRVGLLWVLLLNWYSTVLNPAFNSVEVRTTAYNIWAVINHFSNWLATTLSIFYLLKIANFSNFIFLHLKRRVKSVILVMLLGPLLFLACHLFVINMNEIVRTKEFEGNMTWKIKLKSAMYFSNMTVTMVANLVPFTLTLLSFMLLICSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVISFLLLCAIYFLSIMISVWSFGSLENKPVFMFCKAIRFSYPSIHPFILIWGNKKLKQTFLSVFWQMRYWVKGEKTSSP
Research Backgrounds
Gustducin-coupled receptor immplicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5. Activated by the sulfonyl amide sweeteners saccharin and acesulfame K. In airway epithelial cells, binding of bitter compounds increases the intracellular calcium ion concentration and stimulates ciliary beat frequency. May act as chemosensory receptors in airway epithelial cells to detect and eliminate potential noxious agents from the airways (By similarity).
Membrane>Multi-pass membrane protein. Cell projection>Cilium membrane.
Note: In airway epithelial cells, localizes to motile cilia.
Expressed in subsets of taste receptor cells of the tongue and exclusively in gustducin-positive cells. Expressed in airway epithelia.
Belongs to the G-protein coupled receptor T2R family.
Research Fields
· Organismal Systems > Sensory system > Taste transduction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.