RELT Antibody - #DF8712
Product: | RELT Antibody |
Catalog: | DF8712 |
Description: | Rabbit polyclonal antibody to RELT |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Rat, Bovine, Sheep, Rabbit, Dog |
Mol.Wt.: | 46 kDa; 46kD(Calculated). |
Uniprot: | Q969Z4 |
RRID: | AB_2841916 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8712, RRID:AB_2841916.
Fold/Unfold
Receptor expressed in lymphoid tissues; Relt; TNFRSF19L; TR19L_HUMAN; Tumor necrosis factor receptor superfamily member 19L;
Immunogens
Spleen, lymph node, brain, breast and peripheral blood leukocytes (at protein level) (PubMed:28688764). Expressed highly in bone marrow and fetal liver. Very low levels in skeletal muscle, testis and colon. Not detected in kidney and pancreas.
- Q969Z4 TR19L_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKPSLLCRPLSCFLMLLPWPLATLTSTTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRAGGPEETAAQYAVIAIVPVFCLMGLLGILVCNLLKRKGYHCTAHKEVGPGPGGGGSGINPAYRTEDANEDTIGVLVRLITEKKENAAALEELLKEYHSKQLVQTSHRPVSKLPPAPPNVPHICPHRHHLHTVQGLASLSGPCCSRCSQKKWPEVLLSPEAVAATTPVPSLLPNPTRVPKAGAKAGRQGEITILSVGRFRVARIPEQRTSSMVSEVKTITEAGPSWGDLPDSPQPGLPPEQQALLGSGGSRTKWLKPPAENKAEENRYVVRLSESNLVI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q969Z4 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S140 | Phosphorylation | Uniprot | |
Y214 | Phosphorylation | Uniprot | |
T223 | Phosphorylation | Uniprot | |
K235 | Ubiquitination | Uniprot | |
K246 | Ubiquitination | Uniprot | |
K251 | Ubiquitination | Uniprot | |
S299 | Phosphorylation | Uniprot | |
S309 | Phosphorylation | Uniprot | |
T317 | Phosphorylation | Uniprot | |
S321 | Phosphorylation | Uniprot | |
T327 | Phosphorylation | Uniprot | |
K404 | Ubiquitination | Uniprot |
Research Backgrounds
May play a role in apoptosis. Induces activation of MAPK14/p38 and MAPK8/JNK MAPK cascades, when overexpressed. Involved in dental enamel formation.
Phosphorylated in vitro by OXSR1. Phosphorylated by STK39.
Cell membrane>Single-pass type I membrane protein. Cytoplasm. Cytoplasm>Perinuclear region.
Spleen, lymph node, brain, breast and peripheral blood leukocytes (at protein level). Expressed highly in bone marrow and fetal liver. Very low levels in skeletal muscle, testis and colon. Not detected in kidney and pancreas.
Interacts with TRAF1. Interacts with RELL1, RELL2 and OXSR1. Interacts with PLSCR1. Interacts with STK39.
Belongs to the RELT family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.