OR8B2/B3 Antibody - #DF8704
| Product: | OR8B2/B3 Antibody |
| Catalog: | DF8704 |
| Description: | Rabbit polyclonal antibody to OR8B2/B3 |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Mol.Wt.: | 35 kDa; 35kD(Calculated). |
| Uniprot: | Q96RD0 | Q8NGG8 |
| RRID: | AB_2841908 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8704, RRID:AB_2841908.
Fold/Unfold
Olfactory receptor 8B2; Olfactory receptor 8B3; Olfactory receptor OR11 309; Olfactory receptor OR11 310; Olfactory receptor OR11 311; Olfactory receptor, family 8, subfamily B, member 2; Olfactory receptor, family 8, subfamily B, member 3; OR11 309; OR11 310; OR11 311; Olfactory receptor 8B3; Olfactory receptor OR11-311; Olfactory receptor, family 8, subfamily B, member 3; OR8B3; OR8B3_HUMAN;
Immunogens
A synthesized peptide derived from human OR8B2/B3, corresponding to a region within the internal amino acids.
- Q96RD0 OR8B2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLARNNSLVTEFILAGLTDHPEFRQPLFFLFLVIYIVTMVGNLGLITLFGLNSHLHTPMYYFLFNLSFIDLCYSSVFTPKMLMNFVSKKNIISNVGCMTRLFFFLFFVISECYMLTSMAYDRYVAICNPLLYKVTMSHQVCSMLTFAAYIMGLAGATAHTGCMLRLTFCSANIINHYLCDILPLLQLSCTSTYVNEVVVLIVVGTNITVPSCTILISYVFIVTSILHIKSTQGRSKAFSTCSSHVIALSLFFGSAAFMYIKYSSGSMEQGKVSSVFYTNVVPMLNPLIYSLRNKDVKVALRKALIKIQRRNIF
- Q8NGG8 OR8B3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLARNNSLVTEFILAGLTDHPEFQQPLFFLFLVVYIVTMVGNLGLIILFGLNSHLHTPMYYFLFNLSFIDLCYSSVFTPKMLMNFVSKKNIISYVGCMTQLFFFLFFVISECYMLTSMAYDRYVAICNPLLYKVTMSHQVCSMLTFAAYIMGLAGATAHTGCMLRLTFCSANIINHYLCDILPLLQLSCTSTYVNEVVVLIVVGINIMVPSCTILISYVFIVTSILHIKSTQGRSKAFSTCSSHVIALSLFFGSAAFMYIKYSSGSMEQGKVSSVFYTNVVPMLNPLIYSLRNKDVKVALRKALIKIQRRNIF
Research Backgrounds
Odorant receptor.
Cell membrane>Multi-pass membrane protein.
Belongs to the G-protein coupled receptor 1 family.
Odorant receptor.
Cell membrane>Multi-pass membrane protein.
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Organismal Systems > Sensory system > Olfactory transduction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.