NOX1 Antibody - #DF8684
![](/images/pubmed.gif)
Product: | NOX1 Antibody |
Catalog: | DF8684 |
Description: | Rabbit polyclonal antibody to NOX1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Zebrafish, Bovine, Horse, Rabbit, Dog |
Mol.Wt.: | 64 kDa; 65kD(Calculated). |
Uniprot: | Q9Y5S8 |
RRID: | AB_2841888 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8684, RRID:AB_2841888.
Fold/Unfold
GP91 2; Mitogenic oxidase (pyridine nucleotide dependent superoxide generating); Mitogenic oxidase 1; MOX-1; MOX1; NADH/NADPH mitogenic oxidase subunit P65 MOX; NADH/NADPH mitogenic oxidase subunit P65-MOX; NADPH oxidase 1; NADPH oxidase 1 variant NOH 1L; NADPH oxidase homolog 1; NOH 1; NOH-1; NOH1; NOX-1; Nox1; NOX1_HUMAN; RP1 146H21.1;
Immunogens
NOH-1L is detected in colon, uterus, prostate, and colon carcinoma, but not in peripheral blood leukocytes. NOH-1S is detected only in colon and colon carcinoma cells.
- Q9Y5S8 NOX1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCLNFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHLFNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVIMTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHPRKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGDWTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y5S8 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T49 | Phosphorylation | Uniprot | |
T82 | Phosphorylation | Uniprot | |
T89 | Phosphorylation | Uniprot | |
S160 | Phosphorylation | Uniprot | |
N162 | N-Glycosylation | Uniprot | |
T231 | Phosphorylation | Uniprot | |
S234 | Phosphorylation | Uniprot | |
N236 | N-Glycosylation | Uniprot | |
S238 | Phosphorylation | Uniprot | |
K294 | Ubiquitination | Uniprot | |
T298 | Phosphorylation | Uniprot | |
Y373 | Phosphorylation | Uniprot | |
T453 | Phosphorylation | Uniprot | |
S454 | Phosphorylation | Uniprot | |
Y470 | Phosphorylation | Uniprot | |
S515 | Phosphorylation | Uniprot |
Research Backgrounds
NOH-1S is a voltage-gated proton channel that mediates the H(+) currents of resting phagocytes and other tissues. It participates in the regulation of cellular pH and is blocked by zinc. NOH-1L is a pyridine nucleotide-dependent oxidoreductase that generates superoxide and might conduct H(+) ions as part of its electron transport mechanism, whereas NOH-1S does not contain an electron transport chain.
Cell projection>Invadopodium membrane>Multi-pass membrane protein. Cell membrane.
NOH-1L is detected in colon, uterus, prostate, and colon carcinoma, but not in peripheral blood leukocytes. NOH-1S is detected only in colon and colon carcinoma cells.
NOX1, NOXA1, NOXO1, RAC1 and CYBA forms a functional multimeric complex supporting reactive oxygen species (ROS) production. Interacts with NOXA1 and NOXO1.
Research Fields
· Organismal Systems > Development > Osteoclast differentiation. (View pathway)
References
Application: WB Species: Rat Sample:
Application: WB Species: mouse Sample: kidneys
Application: WB Species: Rat Sample: NRK-52e cells
Application: WB Species: rat Sample: testis
Application: WB Species: Human Sample: HUVECs
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.