NOX1 Antibody - #DF8684

(12)   (11)  
Product: NOX1 Antibody
Catalog: DF8684
Description: Rabbit polyclonal antibody to NOX1
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Zebrafish, Bovine, Horse, Rabbit, Dog
Mol.Wt.: 64 kDa; 65kD(Calculated).
Uniprot: Q9Y5S8
RRID: AB_2841888

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Zebrafish(89%), Bovine(80%), Horse(90%), Rabbit(90%), Dog(90%)
Clonality:
Polyclonal
Specificity:
NOX1 Antibody detects endogenous levels of total NOX1.
RRID:
AB_2841888
Cite Format: Affinity Biosciences Cat# DF8684, RRID:AB_2841888.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

GP91 2; Mitogenic oxidase (pyridine nucleotide dependent superoxide generating); Mitogenic oxidase 1; MOX-1; MOX1; NADH/NADPH mitogenic oxidase subunit P65 MOX; NADH/NADPH mitogenic oxidase subunit P65-MOX; NADPH oxidase 1; NADPH oxidase 1 variant NOH 1L; NADPH oxidase homolog 1; NOH 1; NOH-1; NOH1; NOX-1; Nox1; NOX1_HUMAN; RP1 146H21.1;

Immunogens

Immunogen:
Uniprot:

Q9Y5S8(NOX1_HUMAN) >>Visit HPA database.

Gene(ID):
NOX1(27035)
Expression:
Q9Y5S8 NOX1_HUMAN:

NOH-1L is detected in colon, uterus, prostate, and colon carcinoma, but not in peripheral blood leukocytes. NOH-1S is detected only in colon and colon carcinoma cells.

Sequence:
MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCLNFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHLFNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVIMTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHPRKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGDWTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
90
Dog
90
Rabbit
90
Zebrafish
89
Bovine
80
Chicken
78
Pig
0
Sheep
0
Xenopus
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q9Y5S8 As Substrate

Site PTM Type Enzyme
T49 Phosphorylation
T82 Phosphorylation
T89 Phosphorylation
S160 Phosphorylation
N162 N-Glycosylation
T231 Phosphorylation
S234 Phosphorylation
N236 N-Glycosylation
S238 Phosphorylation
K294 Ubiquitination
T298 Phosphorylation
Y373 Phosphorylation
T453 Phosphorylation
S454 Phosphorylation
Y470 Phosphorylation
S515 Phosphorylation

Research Backgrounds

Function:

NOH-1S is a voltage-gated proton channel that mediates the H(+) currents of resting phagocytes and other tissues. It participates in the regulation of cellular pH and is blocked by zinc. NOH-1L is a pyridine nucleotide-dependent oxidoreductase that generates superoxide and might conduct H(+) ions as part of its electron transport mechanism, whereas NOH-1S does not contain an electron transport chain.

Subcellular Location:

Cell projection>Invadopodium membrane>Multi-pass membrane protein. Cell membrane.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

NOH-1L is detected in colon, uterus, prostate, and colon carcinoma, but not in peripheral blood leukocytes. NOH-1S is detected only in colon and colon carcinoma cells.

Subunit Structure:

NOX1, NOXA1, NOXO1, RAC1 and CYBA forms a functional multimeric complex supporting reactive oxygen species (ROS) production. Interacts with NOXA1 and NOXO1.

Research Fields

· Organismal Systems > Development > Osteoclast differentiation.   (View pathway)

References

1). MicroRNA-204-5p reduction in rat hippocampus contributes to stress-induced pathology via targeting RGS12 signaling pathway. Journal of Neuroinflammation, 2021 (PubMed: 34674723) [IF=9.3]

Application: WB    Species: Rat    Sample:

Fig. 1 Oxidative damage as observed in the hippocampal DG region and vmPFC of CUS rats. A Behavioral responses of FST and SPT in control rats and CUS model rats (N = 50 per group). B Activity of antioxidant enzymes SOD and T-AOC. Contents of MDA and LDH were analyzed and levels were normalized to total protein content (N = 5–6 per group). C Representative western blot images showing relative protein levels NOX1 and NOX4 (N = 6 per group). D Q-PCR analysis of NOX1 and NOX4 mRNA levels of each group. Band intensities were normalized to GAPDH (N = 6 per group). E Representative images of DHE staining (red) within the DG area from each group of rats following ROS analysis (N = 6 per group). Nuclei (blue) are stained with DAPI. Scale bar is 50 μm. F ROS relative intensity analysis after DHE staining in each group *P 
2). Chronic infusion of ELABELA alleviates vascular remodeling in spontaneously hypertensive rats via anti-inflammatory, anti-oxidative and anti-proliferative effects. ACTA PHARMACOLOGICA SINICA, 2022 (PubMed: 35260820) [IF=8.2]
3). Notoginsenoside R1 (NGR1) regulates the AGE-RAGE signaling pathway by inhibiting RUNX2 expression to accelerate ferroptosis in breast cancer cells. Aging, 2024 (PubMed: 38885076) [IF=5.2]

Application: WB    Species: Human    Sample: breast cancer cells

Figure 6 NGR1 induces ferroptosis in breast cancer cells by down-regulating RUNX2. (A) Changes in the concentration of MDA and Fe2+ in MDA-MB-23 and SK-BR-3 cells were detected after NGR1 treatment. (B, C) Changes in the expression of ACSL4, COX2, FIH1, GPX4, and NOX1 proteins were detected by Western blot in MDA-MB-231 and SK-BR-3 cells. (* P < 0.05, ** P < 0.01, *** P < 0.001, **** P < 0.0001).
4). Luteolin targets the AGE-RAGE signaling to mitigate inflammation and ferroptosis in chronic atrophic gastritis. Aging, 2024 (PubMed: 38917486) [IF=5.2]

Application: WB    Species: Rat    Sample: gastric tissue

Figure 5 Luteolin inhibits ferroptosis in rat gastric tissue. (A) Changes in the levels of Fe2+ and MDA in gastric tissues of luteolin-treated rats. (B) Changes in the mRNA expression of FIH1, COX2, ACSL4, GPX4, and NOX1 were detected using qPCR. (C) Western blot analysis of the protein expression levels of FIH1, COX2, ACSL4, GPX4, and NOX1.
5). Enhancer of zeste homolog 2 modulates oxidative stress-mediated pyroptosis in vitro and in a mouse kidney ischemia-reperfusion injury model. FASEB JOURNAL, 2020 (PubMed: 31914694) [IF=4.8]

Application: WB    Species: mouse    Sample: kidneys

Supplementary Figure S4|A,BNADPH oxidases of Nox family consisted of seven Nox homologues and are the prominent source of ROS generation. Nox1, Nox2, and Nox4 were found expressed in kidneys. Our results showed that neither Nox1 nor Nox2 expression levels were affected by H/R injury.
6). Phenolic Compounds from Mori Cortex Ameliorate Sodium Oleate-Induced Epithelial–Mesenchymal Transition and Fibrosis in NRK-52e Cells through CD36. MOLECULES, 2021 (PubMed: 34684716) [IF=4.6]

Application: WB    Species: Rat    Sample: NRK-52e cells

Figure 5 Effects of Y-1 and Y-2 on oxidative stress of NRK-52e cells stimulated by sodium oleate with/without CD36 silences. The expression of NOX1, Nrf2, and Keap1 protein in NRK-52e cells was quantified by Western blot and normalized (n = 3) (A). The levels of SOD and MDA in NRK-52e cells were determined by colorimetric method (n = 6) (B). The levels of ROS in NRK-52e cells were determined by FlowSight multi-dimensional panoramic flow cytometer (n = 3) (C). Compared with NC or NC-sicD36 group, ## p < 0.01; compared with M or M-sicD36 group, * p < 0.05, ** p < 0.01.
7). Protective effect of Berberine on reproductive function and spermatogenesis in diabetic rats via inhibition of ROS/JAK2/NFκB pathway. Andrology, 2020 (PubMed: 32012485) [IF=4.5]

Application: WB    Species: rat    Sample: testis

FIGURE 3|BB attenuates ROS production in the testis of DM rats. (A) Representative Western blot results for NOX5, p22phox, gp91phox, NOX1, NOX3, and NOX4 in the testes of rats from all four groups.
8). Soybean glycinin caused NADPH-oxidase-regulated ROS overproduction and decreased ROS elimination capacity in the mid and distal intestine of juvenile grass carp (Ctenopharyngodon idella). AQUACULTURE, 2020 [IF=4.5]
9). Germacrone protects renal tubular cells against ferroptotic death and ROS release by re-activating mitophagy in diabetic nephropathy. Free radical research, 2023 (PubMed: 37897414) [IF=3.3]
10). Synergistic effect of elevated glucose levels with SARS-CoV-2 spike protein induced NOX-dependent ROS production in endothelial cells. Molecular Biology Reports, 2023 (PubMed: 37289363) [IF=2.8]

Application: WB    Species: Human    Sample: HUVECs

Fig. 1 Protein expression in different doses of S protein induced HUVECs. A. ACE2 and TMPRSS2 protein expression relative to GAPDH analyzed by western blot in different doses of S protein induced HUVECs. B. Relative expression of gray values for ACE2. C. Relative expression of gray values for TMPRSS2. D. NOX1 protein expression relative to GAPDH analyzed by western blot in different doses of S protein induced HUVECs. E. Relative expression of gray values for NOX1. F. NOX2 protein expression relative to GAPDH analyzed by western blot in different doses of S protein induced HUVECs. G. Relative expression of gray values for NOX2. H. NOX3 protein expression relative to GAPDH analyzed by western blot in different doses of S protein induced HUVECs. I. Relative expression of gray values for NOX3. J. NOX4 protein expression relative to GAPDH analyzed by western blot in different doses of S protein induced HUVECs. K. Relative expression of gray values for NOX4
Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.