Product: CNR2 Antibody
Catalog: DF8646
Description: Rabbit polyclonal antibody to CNR2
Application: WB IHC IF/ICC
Reactivity: Human, Mouse
Prediction: Pig, Bovine, Horse, Sheep, Dog
Mol.Wt.: 39 kDa; 40kD(Calculated).
Uniprot: P34972
RRID: AB_2841850

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Prediction:
Pig(86%), Bovine(100%), Horse(86%), Sheep(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
CNR2 Antibody detects endogenous levels of total CNR2.
RRID:
AB_2841850
Cite Format: Affinity Biosciences Cat# DF8646, RRID:AB_2841850.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Cannabinoid receptor 2; Cannabinoid receptor 2 macrophage; CB 2; CB-2; CB2; CNR2; CNR2_HUMAN; CNRII; CX 5; CX5; hCB2; testis-dominant CNR2 isoform CB2;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P34972 CNR2_HUMAN:

Preferentially expressed in cells of the immune system with higher expression in B-cells and NK cells (at protein level). Expressed in skin in suprabasal layers and hair follicles (at protein level). Highly expressed in tonsil and to a lower extent in spleen, peripheral blood mononuclear cells, and thymus. PubMed:14657172 could not detect expression in normal brain. Expressed in brain by perivascular microglial cells and dorsal root ganglion sensory neurons (at protein level). Two isoforms are produced by alternative promoter usage and differ only in the 5' UTR: isoform CB2A is observed predominantly in testis with some expression in brain, while isoform CB2B is predominant in spleen and leukocytes.

Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Bovine
100
Sheep
100
Dog
100
Pig
86
Horse
86
Xenopus
0
Zebrafish
0
Chicken
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P34972 As Substrate

Site PTM Type Enzyme
S29 Phosphorylation
T114 Phosphorylation
Y137 Phosphorylation
Y141 Phosphorylation
S268 Phosphorylation
S326 Phosphorylation
K329 Ubiquitination
S335 Phosphorylation
S336 Phosphorylation
T338 Phosphorylation
T340 Phosphorylation
K345 Ubiquitination
S352 Phosphorylation

Research Backgrounds

Function:

Heterotrimeric G protein-coupled receptor for endocannabinoid 2-arachidonoylglycerol mediating inhibition of adenylate cyclase. May function in inflammatory response, nociceptive transmission and bone homeostasis.

PTMs:

Constitutively phosphorylated on Ser-352; phosphorylation increases cell internalization and desensitizes the receptor.

Subcellular Location:

Cell membrane>Multi-pass membrane protein. Cell projection>Dendrite. Perikaryon.
Note: Localizes to apical dendrite of pyramidal neurons.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Preferentially expressed in cells of the immune system with higher expression in B-cells and NK cells (at protein level). Expressed in skin in suprabasal layers and hair follicles (at protein level). Highly expressed in tonsil and to a lower extent in spleen, peripheral blood mononuclear cells, and thymus.could not detect expression in normal brain. Expressed in brain by perivascular microglial cells and dorsal root ganglion sensory neurons (at protein level). Two isoforms are produced by alternative promoter usage and differ only in the 5' UTR: isoform CB2A is observed predominantly in testis with some expression in brain, while isoform CB2B is predominant in spleen and leukocytes.

Family&Domains:

Belongs to the G-protein coupled receptor 1 family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.

References

1). Activation of Cannabinoid Type 2 Receptor in Microglia Reduces Neuroinflammation through Inhibiting Aerobic Glycolysis to Relieve Hypertension. Biomolecules, 2024 (PubMed: 38540753) [IF=5.5]

Application: WB    Species: Mouse    Sample:

Figure 1 JWH133 (2 mg/kg, 28 days) activated the CB2 receptor on microglia to inhibit AngII-induced hypertension by suppressing glycolytic enzymes and proinflammatory cytokines in the PVN. (a) The expression of the CB2 receptor in microglia was upregulated in the PVN of AngII-induced hypertension mice. Iba1 (blue) and CB2 receptor (red). Scale bar = 10 μm. JWH133 activation of the CB2 receptor inhibited MAP (b), plasma norepinephrine levels (c), proinflammatory factors TNF-α, IL-1β, and IL-6 production (d), glycolytic enzymes PFK and LDHa expression (e) in AngII-induced hypertension mice. The results are expressed as mean ±SEM (n = 5 mice in each group, * p < 0.05, ** p < 0.01, *** p < 0.001). Original blot images can be found in Supplementary File S1.

Application: IF/ICC    Species: Mouse    Sample:

Figure 1 JWH133 (2 mg/kg, 28 days) activated the CB2 receptor on microglia to inhibit AngII-induced hypertension by suppressing glycolytic enzymes and proinflammatory cytokines in the PVN. (a) The expression of the CB2 receptor in microglia was upregulated in the PVN of AngII-induced hypertension mice. Iba1 (blue) and CB2 receptor (red). Scale bar = 10 μm. JWH133 activation of the CB2 receptor inhibited MAP (b), plasma norepinephrine levels (c), proinflammatory factors TNF-α, IL-1β, and IL-6 production (d), glycolytic enzymes PFK and LDHa expression (e) in AngII-induced hypertension mice. The results are expressed as mean ±SEM (n = 5 mice in each group, * p < 0.05, ** p < 0.01, *** p < 0.001). Original blot images can be found in Supplementary File S1.

2). N-linoleyltyrosine ameliorates high-fat diet-induced obesity in C57BL/6 mice via cannabinoid receptor regulation. Frontiers in Endocrinology, 2022 (PubMed: 36111301) [IF=5.2]

Application: WB    Species: Mouse    Sample: brain

Figure 7 Effect of NITyr on the expression of CB1 and CB2 in brain. (A) Western blot analysis of CB1 and CB2. (B) CB1 and CB2 expressions were normalized that of GAPDH. The control or DIO group was treated with Poloxamer 188 aqueous solution. 30 NITyr, 60 NITyr and 100 NITyr were treated with 30 mg/kg NITyr, 60 mg/kg NITyr, 100 mg/kg NITyr, respectively. All values were expressed as means ± SD. (n = 3). * P < 0.05, ** P < 0.01, as compared with the DIO group.

3). CB2 receptor agonist JWH133 activates AMPK to inhibit growth of C6 glioma cells. Open Life Sciences, 2019 (PubMed: 33817171) [IF=2.2]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.