ATP6V0D1 Antibody - #DF8629
Product: | ATP6V0D1 Antibody |
Catalog: | DF8629 |
Description: | Rabbit polyclonal antibody to ATP6V0D1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 40 kDa; 40kD(Calculated). |
Uniprot: | P61421 |
RRID: | AB_2841833 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8629, RRID:AB_2841833.
Fold/Unfold
32 kDa accessory protein; ATP6D; ATP6DV; ATP6V0D1; ATPase H+ transporting lysosomal (vacuolar proton pump) member D; ATPase H+ transporting lysosomal 38kD V0 subunit d; ATPase H+ transporting lysosomal 38kDa V0 subunit d1; ATPase H+ transporting lysosomal V0 subunit d1; H(+) transporting two sector ATPase subunit D; p39; V ATPase 40 KDa accessory protein; V ATPase AC39 subunit; V ATPase subunit d 1; V ATPase subunit D; V-ATPase 40 kDa accessory protein; V-ATPase AC39 subunit; V-ATPase subunit d 1; V-type proton ATPase subunit d 1; VA0D1_HUMAN; Vacuolar ATP synthase subunit d 1; Vacuolar proton pump subunit d 1; VATX; VMA 6; VMA6; VPATPD;
Immunogens
- P61421 VA0D1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P61421 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K24 | Ubiquitination | Uniprot | |
K46 | Ubiquitination | Uniprot | |
K77 | Ubiquitination | Uniprot | |
T224 | Phosphorylation | Uniprot | |
S227 | Phosphorylation | Uniprot | |
T230 | Phosphorylation | Uniprot | |
S233 | Phosphorylation | Uniprot | |
K234 | Ubiquitination | Uniprot | |
K239 | Ubiquitination | Uniprot | |
Y248 | Phosphorylation | Uniprot | |
K265 | Ubiquitination | Uniprot | |
Y270 | Phosphorylation | Uniprot | |
Y271 | Phosphorylation | Uniprot | |
Y274 | Phosphorylation | Uniprot | |
K275 | Ubiquitination | Uniprot | |
S283 | Phosphorylation | Uniprot | |
K288 | Ubiquitination | Uniprot | |
R293 | Methylation | Uniprot | |
K300 | Ubiquitination | Uniprot | |
K343 | Ubiquitination | Uniprot | |
Y347 | Phosphorylation | Uniprot |
Research Backgrounds
Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. May play a role in coupling of proton transport and ATP hydrolysis (By similarity). May play a role in cilium biogenesis through regulation of the transport and the localization of proteins to the cilium (By similarity). In aerobic conditions, involved in intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation.
Membrane>Peripheral membrane protein>Cytoplasmic side.
Note: Localizes to centrosome and the base of the cilium.
Ubiquitous.
V-ATPase is a heteromultimeric enzyme composed of a peripheral catalytic V1 complex (components A to H) attached to an integral membrane V0 proton pore complex (components: a, c, c', c'' and d) (By similarity). Interacts with PIP4P1.
Belongs to the V-ATPase V0D/AC39 subunit family.
Research Fields
· Cellular Processes > Transport and catabolism > Lysosome. (View pathway)
· Cellular Processes > Transport and catabolism > Phagosome. (View pathway)
· Human Diseases > Infectious diseases: Bacterial > Vibrio cholerae infection.
· Human Diseases > Infectious diseases: Bacterial > Epithelial cell signaling in Helicobacter pylori infection.
· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
· Human Diseases > Immune diseases > Rheumatoid arthritis.
· Metabolism > Energy metabolism > Oxidative phosphorylation.
· Metabolism > Global and overview maps > Metabolic pathways.
· Organismal Systems > Nervous system > Synaptic vesicle cycle.
· Organismal Systems > Excretory system > Collecting duct acid secretion.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.