VAMP 1/2/3 Antibody - #DF8628
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8628, RRID:AB_2841832.
Fold/Unfold
CEB; cellubrevin; SYB1; SYB2; synaptobrevin 1; synaptobrevin 2; synaptobrevin 3; synaptobrevin1; synaptobrevin2; synaptobrevin3; VAMP 1; VAMP3; Vesicle associated membrane protein 1; Vesicle associated membrane protein 2; Vesicle associated membrane protein 3; FLJ11460; RATVAMPB; RATVAMPIR; SYB; SYB2; Synaptobrevin 2; Synaptobrevin-2; VAMP 2; VAMP-2; Vamp2; VAMP2_HUMAN; Vesicle associated membrane protein 2; Vesicle-associated membrane protein 2 (synaptobrevin 2); Vesicle-associated membrane protein 2; CEB; Cellubrevin; Synaptobrevin 3; Synaptobrevin-3; VAMP 3; VAMP-3; VAMP3; VAMP3_HUMAN; Vesicle associated membrane protein 3; Vesicle-associated membrane protein 3;
Immunogens
A synthesized peptide derived from human VAMP 1/2/3, corresponding to a region within C-terminal amino acids.
Nervous system, skeletal muscle and adipose tissue.
P63027 VAMP2_HUMAN:Nervous system and skeletal muscle.
- P23763 VAMP1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT
- P63027 VAMP2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
- Q15836 VAMP3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS
PTMs - P23763/P63027/Q15836 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K52 | Ubiquitination | Uniprot | |
| K59 | Ubiquitination | Uniprot | |
| S61 | Phosphorylation | Uniprot | |
| R66 | Methylation | Uniprot | |
| S75 | Phosphorylation | Uniprot | |
| T79 | Phosphorylation | Uniprot | |
| S80 | Phosphorylation | Uniprot | |
| K83 | Ubiquitination | Uniprot | |
| K85 | Ubiquitination | Uniprot | |
| K91 | Ubiquitination | Uniprot |
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S2 | Phosphorylation | Uniprot | |
| K54 | Ubiquitination | Uniprot | |
| K61 | Ubiquitination | Uniprot | |
| S63 | Phosphorylation | Uniprot | |
| K85 | Ubiquitination | Uniprot |
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S2 | Acetylation | Uniprot | |
| S2 | Phosphorylation | Uniprot | |
| T3 | Phosphorylation | Uniprot | |
| T9 | Phosphorylation | Uniprot | |
| S11 | Phosphorylation | Uniprot | |
| T18 | Phosphorylation | Uniprot | |
| K35 | Ubiquitination | Uniprot | |
| K42 | Ubiquitination | Uniprot | |
| S44 | Phosphorylation | Uniprot | |
| R49 | Methylation | Uniprot | |
| S58 | Phosphorylation | Uniprot | |
| T62 | Phosphorylation | Uniprot | |
| S63 | Phosphorylation | Uniprot | |
| K66 | Ubiquitination | Uniprot | |
| K68 | Ubiquitination | Uniprot |
Research Backgrounds
Involved in the targeting and/or fusion of transport vesicles to their target membrane.
(Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type B (BoNT/B, botB) which probably hydrolyzes the 78-Gln-|-Phe-79 bond and inhibits neurotransmitter release.
(Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type D (BoNT/D, botD) which probably hydrolyzes the 61-Arg-|-Leu-62 bond and inhibits neurotransmitter release. BoNT/D has low catalytic activity on this protein due to its sequence. Note that humans are not known to be infected by C.botulinum type D.
(Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type F (BoNT/F, botF) which probably hydrolyzes the 60-Gln-|-Lys-61 bond and inhibits neurotransmitter release.
(Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type X (BoNT/X) which probably hydrolyzes the 68-Arg-|-Ala-69 bond and inhibits neurotransmitter release. It remains unknown whether BoNT/X is ever produced, or what organisms it targets.
Cytoplasmic vesicle>Secretory vesicle>Synaptic vesicle membrane>Single-pass type IV membrane protein. Cell junction>Synapse>Synaptosome.
Cytoplasmic vesicle membrane>Single-pass type IV membrane protein. Cell junction>Synapse>Synaptosome.
Mitochondrion outer membrane>Single-pass type IV membrane protein.
Nervous system, skeletal muscle and adipose tissue.
Interacts with VAPA and VAPB.
Belongs to the synaptobrevin family.
Involved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.
Phosphorylated by PRKCZ in vitro and this phosphorylation is increased in the presence of WDFY2.
(Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type B (BoNT/B, botB) which hydrolyzes the 76-Gln-|-Phe-77 bond and probably inhibits neurotransmitter release.
(Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type D (BoNT/D, botD) which probably hydrolyzes the 59-Lys-|-Leu-60 bond and inhibits neurotransmitter release. Note that humans are not known to be infected by C.botulinum type D.
(Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type F (BoNT/F, botF) which hydrolyzes the 58-Gln-|-Lys-59 bond and probably inhibits neurotransmitter release.
(Microbial infection) Targeted and hydrolyzed by C.tetani tetanus toxin (tetX) which hydrolyzes the 76-Gln-|-Phe-77 bond and probably inhibits neurotransmitter release.
Cytoplasmic vesicle>Secretory vesicle>Synaptic vesicle membrane>Single-pass type IV membrane protein. Cell junction>Synapse>Synaptosome. Cell membrane.
Note: Neuronal synaptic vesicles. Colocalizes with PRKCZ and WDFY2 in intracellular vesicles (PubMed:17313651).
Nervous system and skeletal muscle.
Interacts (via N-terminus) with KCNB1 (via N-terminus and C-terminus); stimulates the channel inactivation rate of KCNB1 (By similarity). Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A. This complex binds to CPLX1. Interacts with BVES and STX4 (By similarity). Interacts with VAPA and VAPB. Interacts with WDFY2, PRKCZ and PRKCI. Forms a complex with WDFY2 and PRKCZ. Interacts with SEPT8; the interaction inhibits interaction of VAMP2 with SYP. Interacts with SYP; the interaction is inhibited by interaction with SEPT8 (By similarity). Interacts with PICALM. Interacts with alpha-synuclein/SNCA. Interacts with STX3 (By similarity).
Belongs to the synaptobrevin family.
SNARE involved in vesicular transport from the late endosomes to the trans-Golgi network.
(Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type B (BoNT/B, botB) which hydrolyzes the 59-Gln-|-Phe-60 bond and probably inhibits neurotransmitter release.
(Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type D (BoNT/D, botD) which hydrolyzes the 42-Lys-|-Leu-43 bond and probably inhibits neurotransmitter release. Note that humans are not known to be infected by C.botulinum type D.
(Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type F (BoNT/F, botF) which hydrolyzes the 41-Gln-|-Lys-42 bond and probably inhibits neurotransmitter release.
Membrane>Single-pass type IV membrane protein. Cell junction>Synapse>Synaptosome.
Interacts with BVES (via the C-terminus cytoplasmic tail). Interacts with BCAP31; involved in VAMP3 export from the endoplasmic reticulum (By similarity). Interacts with BAIAP3; this interaction is increased in the presence of calcium. Interacts with PICALM.
Belongs to the synaptobrevin family.
Research Fields
· Cellular Processes > Transport and catabolism > Phagosome. (View pathway)
· Genetic Information Processing > Folding, sorting and degradation > SNARE interactions in vesicular transport.
· Organismal Systems > Nervous system > Synaptic vesicle cycle.
· Organismal Systems > Endocrine system > Insulin secretion. (View pathway)
· Organismal Systems > Excretory system > Vasopressin-regulated water reabsorption.
· Organismal Systems > Digestive system > Salivary secretion.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.