Trypsin-3 Antibody - #DF8625
Product: | Trypsin-3 Antibody |
Catalog: | DF8625 |
Description: | Rabbit polyclonal antibody to Trypsin-3 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Mol.Wt.: | 32 kDa; 33kD(Calculated). |
Uniprot: | P35030 |
RRID: | AB_2841829 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8625, RRID:AB_2841829.
Fold/Unfold
Brain trypsinogen; Mesotrypsin; Mesotrypsinogen; MTG; Pancreatic trypsinogen III; Protease, serine, 3; Protease, serine, 4 (trypsin 4, brain); PRSS3; PRSS4; Serine protease 3; Serine protease 4; T9; TRY3; TRY3_HUMAN; TRY4; Trypsin 3; Trypsin III; Trypsin IV; Trypsin-3; Trypsinogen 4; Trypsinogen 5; Trypsinogen IV;
Immunogens
Detected in pancreas and pancreatic fluid (at protein level) (PubMed:6698368). Expressed in pancreas and brain (PubMed:8294000). Detected in ileum (PubMed:12021776).
- P35030 TRY3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MCGPDDRCPARWPGPGRAVKCGKGLAAARPGRVERGGAQRGGAGLELHPLLGGRTWRAARDADGCEALGTVAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS
PTMs - P35030 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K136 | Acetylation | Uniprot | |
K149 | Ubiquitination | Uniprot | |
K155 | Ubiquitination | Uniprot | |
K169 | Ubiquitination | Uniprot | |
Y232 | Phosphorylation | Uniprot |
Research Backgrounds
Digestive protease that cleaves proteins preferentially after an Arg residue and has proteolytic activity toward Kunitz-type trypsin inhibitors.
Secreted.
Detected in pancreas and pancreatic fluid (at protein level). Expressed in pancreas and brain. Detected in ileum.
Belongs to the peptidase S1 family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
· Human Diseases > Infectious diseases: Viral > Influenza A.
· Organismal Systems > Digestive system > Pancreatic secretion.
· Organismal Systems > Digestive system > Protein digestion and absorption.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.