St3Gal-III Antibody - #DF8617
| Product: | St3Gal-III Antibody |
| Catalog: | DF8617 |
| Description: | Rabbit polyclonal antibody to St3Gal-III |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Chicken, Xenopus |
| Mol.Wt.: | 42 kDa; 42kD(Calculated). |
| Uniprot: | Q11203 |
| RRID: | AB_2841821 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8617, RRID:AB_2841821.
Fold/Unfold
3 sialyltransferase; 3(4) GlcNAc alpha-2; 3-sialyltransferase 3; 3-sialyltransferase; 3-ST 3; 4-galactoside alpha-2; 4GlcNAc alpha 2 3 sialyltransferase; Alpha 2 3 sialyltransferase II; Alpha 2 3 sialyltransferase III; Alpha 2 3 ST 3; Alpha 2; Beta galactoside alpha 3 sialyltransferase 3; Beta-galactoside alpha-2; CMP N acetylneuraminate beta 1 4 galactoside alpha 2 3 sialyltransferase; CMP-N-acetylneuraminate-beta-1; EC 2.4.99.6; Gal beta 1 3; Gal beta 1 3(4) GlcNAc alpha 2 3 sialyltransferase; Gal beta 1 3(4)GlcNAc alpha 2 3 sialyltransferase; Gal beta-1; N acetyllactosaminide alpha 2 3 sialyltransferase; N-acetyllactosaminide alpha-2; OTTHUMP00000008820; OTTHUMP00000008821; OTTHUMP00000008822; OTTHUMP00000008823; Sialyltransferase 6 (N acetyllacosaminide alpha 2 3 sialyltransferase); Sialyltransferase 6; SIAT6; SIAT6_HUMAN; ST3 beta galactoside alpha 2 3 sialyltransferase 3; ST3 beta galactoside alpha 2,3 sialyltransferase 3; ST3Gal III; St3gal3; ST3GALII; ST3GalIII; ST3N;
Immunogens
Highly expressed in adult skeletal muscle and in all fetal tissues examined and to a much lesser extent in placenta, lung and liver.
- Q11203 SIAT6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q11203 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S154 | Phosphorylation | Uniprot | |
| S173 | Phosphorylation | Uniprot | |
| K202 | Ubiquitination | Uniprot | |
| Y220 | Phosphorylation | Uniprot | |
| Y241 | Phosphorylation | Uniprot | |
| Y244 | Phosphorylation | Uniprot | |
| T369 | Phosphorylation | Uniprot | |
| S373 | Phosphorylation | Uniprot |
Research Backgrounds
Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- and NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. The highest activity is toward Gal-beta-1,3-GlcNAc and the lowest toward Gal-beta-1,3-GalNAc.
The soluble form derives from the membrane form by proteolytic processing.
Golgi apparatus>Golgi stack membrane>Single-pass type II membrane protein. Secreted.
Note: Membrane-bound form in trans cisternae of Golgi. Secreted into the body fluid.
Highly expressed in adult skeletal muscle and in all fetal tissues examined and to a much lesser extent in placenta, lung and liver.
Belongs to the glycosyltransferase 29 family.
Research Fields
· Metabolism > Glycan biosynthesis and metabolism > Other types of O-glycan biosynthesis.
· Metabolism > Glycan biosynthesis and metabolism > Glycosaminoglycan biosynthesis - keratan sulfate.
· Metabolism > Glycan biosynthesis and metabolism > Glycosphingolipid biosynthesis - lacto and neolacto series.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.