OCT1 Antibody | Affinity Biosciences

Cites

1/1

Product:	OCT1 Antibody
Catalog:	DF8586
Description:	Rabbit polyclonal antibody to OCT1
Application:	WB
Reactivity:	Human, Rat
Mol.Wt.:	61 kDa; 61kD(Calculated).
Uniprot:	O15245
RRID:	AB_2841790

View similar products>>

Related products

Secondary Antibodies
Blocking Peptides

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MS Report

HPLC Report

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:1000-3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Rat

Clonality:

Polyclonal

Specificity:

OCT1 Antibody detects endogenous levels of total OCT1.

RRID:

AB_2841790
Cite Format: Affinity Biosciences Cat# DF8586, RRID:AB_2841790.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

hOCT1; OCT1; oct1_cds; Organic cation transporter 1; S22A1_HUMAN; Slc22a1; solute carrier family 22 (organic cation transporter), member 1; Solute carrier family 22 member 1;

Immunogens

Immunogen:

A synthesized peptide derived from human OCT1, corresponding to a region within N-terminal amino acids.

Uniprot:

O15245(S22A1_HUMAN) >>Visit HPA database.

Gene(ID):

SLC22A1(6580)

Expression:

O15245 S22A1_HUMAN:

Widely expressed with high level in liver. Isoform 1 and isoform 2 are expressed in liver. Isoform 1, isoform 2, isoform 3 and isoform 4 are expressed in glial cell lines.

Sequence:

O15245 S22A1_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MPTVDDILEQVGESGWFQKQAFLILCLLSAAFAPICVGIVFLGFTPDHHCQSPGVAELSQRCGWSPAEELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLDLFQSCLNAGFLFGSLGVGYFADRFGRKLCLLGTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMYQMAFTVGLVALTGLAYALPHWRWLQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIKIMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFILMYLWFTDSVLYQGLILHMGATSGNLYLDFLYSALVEIPGAFIALITIDRVGRIYPMAMSNLLAGAACLVMIFISPDLHWLNIIIMCVGRMGITIAIQMICLVNAELYPTFVRNLGVMVCSSLCDIGGIITPFIVFRLREVWQALPLILFAVLGLLAAGVTLLLPETKGVALPETMKDAENLGRKAKPKENTIYLKVQTSEPSGT

PTMs - O15245 As Substrate

O15245

Site	PTM Type	Source
S196	Phosphorylation	Uniprot
Y361	Phosphorylation	Uniprot
T541	Phosphorylation	Uniprot

Research Backgrounds

O15245_S22A1_HUMAN

Function:

Translocates a broad array of organic cations with various structures and molecular weights including the model compounds 1-methyl-4-phenylpyridinium (MPP), tetraethylammonium (TEA), N-1-methylnicotinamide (NMN), 4-(4-(dimethylamino)styryl)-N-methylpyridinium (ASP), the endogenous compounds choline, guanidine, histamine, epinephrine, adrenaline, noradrenaline and dopamine, and the drugs quinine, and metformin. The transport of organic cations is inhibited by a broad array of compounds like tetramethylammonium (TMA), cocaine, lidocaine, NMDA receptor antagonists, atropine, prazosin, cimetidine, TEA and NMN, guanidine, cimetidine, choline, procainamide, quinine, tetrabutylammonium, and tetrapentylammonium. Translocates organic cations in an electrogenic and pH-independent manner. Translocates organic cations across the plasma membrane in both directions. Transports the polyamines spermine and spermidine. Transports pramipexole across the basolateral membrane of the proximal tubular epithelial cells. The choline transport is activated by MMTS. Regulated by various intracellular signaling pathways including inhibition by protein kinase A activation, and endogenously activation by the calmodulin complex, the calmodulin-dependent kinase II and LCK tyrosine kinase.

PTMs:

Phosphorylated.

Subcellular Location:

Basolateral cell membrane>Multi-pass membrane protein.

Tissue Specificity:

Widely expressed with high level in liver. Isoform 1 and isoform 2 are expressed in liver. Isoform 1, isoform 2, isoform 3 and isoform 4 are expressed in glial cell lines.

Family&Domains:

Belongs to the major facilitator (TC 2.A.1) superfamily. Organic cation transporter (TC 2.A.1.19) family.

Research Fields

· Human Diseases > Cancers: Overview > Choline metabolism in cancer. (View pathway)

References

1). CP-25 improves nephropathy in collagen-induced arthritis rats by inhibiting the renal inflammatory response. International Immunopharmacology, 2020 (PubMed: 33182042) [IF=5.6]

Application: WB Species: rats Sample: Spleen tissue

Fig. 7. CP-25 upregulated renal OAT1 and OCT1 expression in CIA rats. Expression of the renal transporters OAT1 and OCT1 were measured by western blotting and semi-quantitatively analysed based on the internal reference Na+/K+ ATPase. The data are presented as the mean ± SD, N = 4, ##P &lt; 0.01 vs. the normal group; **P &lt; 0.01 vs. the CIA model group. Bonferroni’s test was used for multiple comparisons between groups.

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

OCT1 Antibody - #DF8586