IDH3B Antibody - #DF8562
Product: | IDH3B Antibody |
Catalog: | DF8562 |
Description: | Rabbit polyclonal antibody to IDH3B |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Horse, Dog |
Mol.Wt.: | 42 kDa; 42kD(Calculated). |
Uniprot: | O43837 |
RRID: | AB_2841766 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8562, RRID:AB_2841766.
Fold/Unfold
FLJ11043; H-IDHB; Idh3B; IDH3B_HUMAN; Isocitrate dehydrogenase [NAD] subunit beta; Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial; isocitrate dehydrogenase 3, beta subunit; Isocitric dehydrogenase; Isocitric dehydrogenase subunit beta; MGC903; mitochondrial; NAD(+)-specific ICDH; NAD(+)-specific ICDH subunit beta; NAD+-specific isocitrate dehydrogenase b subunit; NAD+-specific isocitrate dehydrogenase beta; OTTHUMP00000030023; OTTHUMP00000030024; RP46;
Immunogens
- O43837 IDH3B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAALSGVRWLTRALVSAGNPGAWRGLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O43837 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S5 | Phosphorylation | Uniprot | |
T11 | Phosphorylation | Uniprot | |
K96 | Acetylation | Uniprot | |
K96 | Ubiquitination | Uniprot | |
K105 | Ubiquitination | Uniprot | |
T117 | Phosphorylation | Uniprot | |
Y121 | Phosphorylation | Uniprot | |
K135 | Ubiquitination | Uniprot | |
K146 | Acetylation | Uniprot | |
T167 | Phosphorylation | Uniprot | |
Y171 | Phosphorylation | Uniprot | |
S172 | Phosphorylation | Uniprot | |
S173 | Phosphorylation | Uniprot | |
S178 | Phosphorylation | Uniprot | |
K199 | Acetylation | Uniprot | |
K199 | Ubiquitination | Uniprot | |
K207 | Acetylation | Uniprot | |
K212 | Ubiquitination | Uniprot | |
K218 | Acetylation | Uniprot | |
K218 | Ubiquitination | Uniprot | |
K242 | Ubiquitination | Uniprot | |
S330 | Phosphorylation | Uniprot | |
K350 | Acetylation | Uniprot | |
Y366 | Phosphorylation | Uniprot | |
T368 | Phosphorylation | Uniprot | |
T369 | Phosphorylation | Uniprot | |
K374 | Acetylation | Uniprot | |
S375 | Phosphorylation | Uniprot | |
K383 | Ubiquitination | Uniprot |
Research Backgrounds
Plays a structural role to facilitate the assembly and ensure the full activity of the enzyme catalyzing the decarboxylation of isocitrate (ICT) into alpha-ketoglutarate. The heterodimer composed of the alpha (IDH3A) and beta (IDH3B) subunits and the heterodimer composed of the alpha (IDH3A) and gamma (IDH3G) subunits, have considerable basal activity but the full activity of the heterotetramer (containing two subunits of IDH3A, one of IDH3B and one of IDH3G) requires the assembly and cooperative function of both heterodimers.
Mitochondrion.
Heterooligomer of subunits alpha (IDH3A), beta (IDH3B), and gamma (IDH3G) in the apparent ratio of 2:1:1. The heterodimer containing one IDH3A and one IDH3B subunit and the heterodimer containing one IDH3A and one IDH3G subunit assemble into a heterotetramer (which contains two subunits of IDH3A, one of IDH3B and one of IDH3G) and further into the heterooctamer.
Belongs to the isocitrate and isopropylmalate dehydrogenases family.
Research Fields
· Metabolism > Carbohydrate metabolism > Citrate cycle (TCA cycle).
· Metabolism > Global and overview maps > Metabolic pathways.
· Metabolism > Global and overview maps > Carbon metabolism.
· Metabolism > Global and overview maps > 2-Oxocarboxylic acid metabolism.
· Metabolism > Global and overview maps > Biosynthesis of amino acids.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.