Product: IDH2 Antibody
Catalog: DF8561
Source: Rabbit
Application: WB, IF/ICC, IHC-P
Reactivity: Human, Mouse, Rat, Monkey
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 50 kDa; 51kD(Calculated).
Uniprot: P48735
RRID: AB_2841765

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat,Monkey
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(88%)
Clonality:
Polyclonal
Specificity:
IDH2 Antibody detects endogenous levels of total IDH2.
RRID:
AB_2841765
Cite Format: Affinity Biosciences Cat# DF8561, RRID:AB_2841765.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

D2HGA2; ICD-M; IDH; IDH2; IDHM; IDHP_HUMAN; IDP; IDPM; Isocitrate dehydrogenase [NADP], mitochondrial; Isocitrate dehydrogenase 2 (NADP+), mitochondrial; mNADP-IDH; NADP(+)-specific ICDH; Oxalosuccinate decarboxylase;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Sequence:
MAGYLRVVRSLCRASGSRPAWAPAALTAPTSQEQPRRHYADKRIKVAKPVVEMDGDEMTRIIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Rabbit
100
Chicken
88
Xenopus
71
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P48735 As Substrate

Site PTM Type Enzyme
K48 Acetylation
K67 Acetylation
K69 Acetylation
K69 Ubiquitination
K80 Acetylation
K80 Ubiquitination
T97 Phosphorylation
S100 Phosphorylation
K106 Acetylation
K106 Ubiquitination
Y107 Phosphorylation
S108 Phosphorylation
K112 Ubiquitination
T115 Phosphorylation
T117 Phosphorylation
K127 Acetylation
K127 Ubiquitination
K133 Acetylation
S134 Phosphorylation
T146 Phosphorylation
K155 Acetylation
K155 Ubiquitination
K166 Acetylation
K166 Ubiquitination
Y179 Phosphorylation
K180 Acetylation
K180 Ubiquitination
T182 Phosphorylation
R188 Methylation
T191 Phosphorylation
K193 Ubiquitination
T197 Phosphorylation
K199 Ubiquitination
K242 Acetylation
Y247 Phosphorylation
K256 Acetylation
K256 Ubiquitination
K263 Acetylation
K263 Ubiquitination
K272 Acetylation
K272 Ubiquitination
K275 Acetylation
K275 Ubiquitination
K280 Acetylation
K282 Acetylation
K282 Ubiquitination
S301 Phosphorylation
C308 S-Nitrosylation
T350 Phosphorylation
K384 Acetylation
K384 Ubiquitination
K400 Ubiquitination
K413 Acetylation
K413 Ubiquitination
S423 Phosphorylation
K426 Ubiquitination
K442 Acetylation
K442 Ubiquitination

Research Backgrounds

Function:

Plays a role in intermediary metabolism and energy production. It may tightly associate or interact with the pyruvate dehydrogenase complex.

PTMs:

Acetylation at Lys-413 dramatically reduces catalytic activity. Deacetylated by SIRT3.

Subcellular Location:

Mitochondrion.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Homodimer.

Family&Domains:

Belongs to the isocitrate and isopropylmalate dehydrogenases family.

Research Fields

· Cellular Processes > Transport and catabolism > Peroxisome.   (View pathway)

· Metabolism > Carbohydrate metabolism > Citrate cycle (TCA cycle).

· Metabolism > Metabolism of other amino acids > Glutathione metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

· Metabolism > Global and overview maps > Carbon metabolism.

· Metabolism > Global and overview maps > 2-Oxocarboxylic acid metabolism.

· Metabolism > Global and overview maps > Biosynthesis of amino acids.

References

1). Fu X et al. Molecular mechanism of albumin in suppressing invasion and metastasis of hepatocellular carcinoma. Liver Int 2022 Mar;42(3):696-709. (PubMed: 34854209) [IF=8.754]

Application: WB    Species: Human    Sample: HepG2 cells

FIGURE 5 Verification of the differentially expressed proteins. A, the RT‐PCR detected the relative mRNA expression levels of AZGP1, GPC3, CTSF, NOTCH1, CTSD, uPAR, BMP2, LCN2, IDH2 and RPS3A (*P < .05). B, A representative western blot analysis for AZGP1, GPC3, NOTCH1, CTSD, uPAR, BMP2, LCN2, IDH2 and RPS3A expression in intracellular and extracellular samples from HepG2 cells. (Bars indicate SD, *P < .05)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.