Product: GRO gamma Antibody
Catalog: DF8554
Description: Rabbit polyclonal antibody to GRO gamma
Application: WB IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 11 kDa; 11kD(Calculated).
Uniprot: P19876
RRID: AB_2841758

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
GRO gamma Antibody detects endogenous levels of total GRO gamma.
RRID:
AB_2841758
Cite Format: Affinity Biosciences Cat# DF8554, RRID:AB_2841758.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

C-X-C motif chemokine 3; C-X-C motif chemokine ligand 3; Chemokine (C X C motif) ligand 3; Chemokine (CXC motif) ligand 3; Cinc 2; CINC 2b; Cinc2; CINC2b; CXCL 3; Cxcl3; CXCL3_HUMAN; Cytokine induced neutrophil chemoattractant 2; Dcip1; Dendritic cell inflammatory protein 1; Gm1960; GRO protein gamma; GRO-gamma; GRO-gamma(1-73); GRO-gamma(5-73); GRO3; GRO3 oncogene; GROG; Growth regulated protein gamma; Growth-regulated protein gamma; Macrophage inflammatory protein 2 beta precursor; Macrophage inflammatory protein 2-beta; Melanoma growth stimulatory activity gamma; Member 3; MGSA gamma; MIP 2b; MIP2-beta; MIP2B; SCYB3; Small inducible cytokine subfamily B;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Sequence:
MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN

Research Backgrounds

Function:

Ligand for CXCR2 (By similarity). Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes.

PTMs:

N-terminal processed form GRO-gamma(5-73) is produced by proteolytic cleavage after secretion from peripheral blood monocytes.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the intercrine alpha (chemokine CxC) family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Environmental Information Processing > Signal transduction > TNF signaling pathway.   (View pathway)

· Human Diseases > Infectious diseases: Bacterial > Salmonella infection.

· Human Diseases > Infectious diseases: Bacterial > Legionellosis.

· Organismal Systems > Immune system > Chemokine signaling pathway.   (View pathway)

· Organismal Systems > Immune system > NOD-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > IL-17 signaling pathway.   (View pathway)

References

1). HDAC6-MYCN-CXCL3 axis mediates allergic inflammation and is necessary for allergic inflammation-promoted cellular interactions. Molecular immunology, 2024 (PubMed: 38176167) [IF=3.6]

2). Upregulation of ITGB6 in primary palmar hyperhidrosis. Advances in clinical and experimental medicine : official organ Wroclaw Medical University, 2023 (PubMed: 37212774) [IF=2.1]

Application: WB    Species: Human    Sample:

Fig. 6. Regulatory effects of integrin β6 (ITGB6) on CXCL3, CXCL5, CXCL10, CXCL11, and WNT2 expression levels in sweat gland cells. Sweat gland cells extracted from patients with primary palmar hyperhidrosis were treated with blank control or transfected with overexpression negative control (OE NC) or ITGB6 OE. The CXCL3, CXCL5, CXCL10, CXCL11, and WNT2 (A) mRNA (ITGB6 OE compared to control, Tukey’s honest significant difference (HSD), p < 0.001, all), and (B,C) protein expression (ITGB6 OE compared to control, CXCL3, CXCL5, and CXCL11: Tukey’s HSD, all p < 0.001; CXCL10: Tukey’s HSD, p = 0.004; WNT2: Tukey’s HSD, p = 0.027). The data are presented as mean ± 95% confidence interval (95% CI)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.