ECP Antibody - #DF8536
Product: | ECP Antibody |
Catalog: | DF8536 |
Description: | Rabbit polyclonal antibody to ECP |
Application: | WB IHC |
Reactivity: | Human, Monkey |
Mol.Wt.: | 18 kDa; 18kD(Calculated). |
Uniprot: | P12724 |
RRID: | AB_2841740 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8536, RRID:AB_2841740.
Fold/Unfold
Cytotoxic ribonuclease; ECP; ECP_HUMAN; Eosinophil cationic protein; OTTHUMP00000164017; Ribonuclease 3; Ribonuclease, RNase A family, 3; RNase 3; RNASE3; RNS3;
Immunogens
- P12724 ECP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVPKLFTSQICLLLLLGLMGVEGSLHARPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI
PTMs - P12724 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y149 | Phosphorylation | Uniprot | |
T158 | Phosphorylation | Uniprot | |
T159 | Phosphorylation | Uniprot |
Research Backgrounds
Cytotoxin and helminthotoxin with low-efficiency ribonuclease activity. Possesses a wide variety of biological activities. Exhibits antibacterial activity, including cytoplasmic membrane depolarization of preferentially Gram-negative, but also Gram-positive strains. Promotes E.coli outer membrane detachment, alteration of the overall cell shape and partial loss of cell content.
Secreted.
Note: Located in the matrix of eosinophil large specific granule, which are released following activation by an immune stimulus.
Interacts with bacterial lipopolysaccharide (LPS) and lipoteichoic acid (LTA). In vitro interacts with and insert into lipid bilayers composed of dioleoyl phosphatidylcholine and dioleoyl phosphatidylglycerol. In vitro, tends to form amyloid-like aggregates at pH 3, but not at pH 5, nor 7.
Belongs to the pancreatic ribonuclease family.
Research Fields
· Human Diseases > Immune diseases > Asthma.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.