DIO3 Antibody - #DF8532
(1)
(3)
| Product: | DIO3 Antibody |
| Catalog: | DF8532 |
| Description: | Rabbit polyclonal antibody to DIO3 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat, Monkey |
| Prediction: | Pig, Bovine, Sheep, Dog |
| Mol.Wt.: | 31 kDa; 34kD(Calculated). |
| Uniprot: | P55073 |
| RRID: | AB_2841736 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8532, RRID:AB_2841736.
Fold/Unfold
5DIII; D3; Deiodinase iodothyronine type 3; Deiodinase iodothyronine type III; Dio 3; Dio3; DIOIII; IOD3_HUMAN; Iodothyronine deiodinase placental type; MGC124117; MGC124118; Thyroxine deiodinase type III; Thyroxine deiodinase type III (selenoprotein); TXDI3; Type 3 DI; Type 3 iodothyronine selenodeiodinase; Type III 5' deiodinase; Type III iodothyronine deiodinase; Type-III 5''-deiodinase;
Immunogens
A synthesized peptide derived from human DIO3, corresponding to a region within the internal amino acids.
- P55073 IOD3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPRQATSRLVVGEGEGSQGASGPAATMLRSLLLHSLRLCAQTASCLVLFPRFLGTAFMLWLLDFLCIRKHFLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVLPDGFQSQHILDYAQGNRPLVLNFGSCTUPPFMARMSAFQRLVTKYQRDVDFLIIYIEEAHPSDGWVTTDSPYIIPQHRSLEDRVSAARVLQQGAPGCALVLDTMANSSSSAYGAYFERLYVIQSGTIMYQGGRGPDGYQVSELRTWLERYDEQLHGARPRRV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P55073 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S252 | Phosphorylation | Uniprot |
Research Backgrounds
Responsible for the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into RT3 (3,3',5'-triiodothyronine) and of T3 (3,5,3'-triiodothyronine) into T2 (3,3'-diiodothyronine). RT3 and T2 are inactive metabolites. May play a role in preventing premature exposure of developing fetal tissues to adult levels of thyroid hormones. Can regulate circulating fetal thyroid hormone concentrations throughout gestation. Essential role for regulation of thyroid hormone inactivation during embryological development.
Cell membrane>Single-pass type II membrane protein. Endosome membrane>Single-pass type II membrane protein.
Expressed in placenta and several fetal tissues.
Homodimer. May undergo minor heretodimerization with DIO1 and DIO2.
Belongs to the iodothyronine deiodinase family.
Research Fields
· Organismal Systems > Endocrine system > Thyroid hormone signaling pathway. (View pathway)
References
Application: WB Species: Mouse Sample: ESCs
Application: WB Species: Mouse Sample: ESCs
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.